(data stored in ACNUC9435 zone)

EMBL: CP000904.PE285

CP000904.PE285       Location/Qualifiers
FT   CDS_pept        413482..414813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5760"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; KEGG: sen:SACE_6672
FT                   metalloendopeptidase-like membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5760"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY8"
FT                   /protein_id="ABY46709.1"
FT                   /translation="MATNKQTFNIEVYKRKIKAGKEEYAKRKEFLAKFNLPKLNDDEEE
FT                   VEEKPSDDSKKTEDQGNAVKEPDGGVGNFTGSGELSVPAEPKSYRFTSVMGARWGTTHN
FT                   GVDLAPNTPGDTNCKILSAGDGVVLQARSGVGGFGTWIVIKHKDDLYTIYGHMHPSTLK
FT                   VKSGDAVKRGQHIANMGMQGESTGVHLHFEVCTDFVNNRRGTTKNPEDYVNVRASASKI
FT                   EVNSFAPQAKFSAKADTKEEGNEKTMHPHYDNDGAELSEEEKLIDQTYRSSFPYLPVQF
FT                   IGDSIKKNDITREFFLLNRVGWARTTKYEKMVSLHKERFIHSEKYDGHEGNLYSPDAKR
FT                   LFESLLLKTQKPYFEVISGFRFSNDGQLSPHEAGCAIDILVKSIDEVREIADCAWLLGV
FT                   RSIAIGGDFENNKGFIHLDIAPKGKDFMYDGVPIYGGPGKWVTQ"
     atggctacaa acaagcaaac ctttaacata gaggtttata agagaaaaat taaggctggt        60
     aaggaagagt atgccaagag aaaagagttc cttgctaaat tcaatctccc taaacttaat       120
     gacgatgaag aagaagtaga agaaaaacct tctgatgata gtaaaaaaac tgaagaccaa       180
     gggaacgcag ttaaagaacc cgatggtgga gttggtaact tcacaggttc tggtgaacta       240
     tctgtacccg cagagcctaa atcatacaga ttcacttctg tgatgggtgc tcgttgggga       300
     acaacacata atggagtgga cttagcccct aatactcctg gtgataccaa ctgcaagata       360
     ctttctgcag gtgatggagt tgttcttcaa gctagaagcg gagtaggtgg gtttggtact       420
     tggatagtta ttaaacataa ggatgacttg tatacgattt atggtcatat gcatcctagt       480
     acactaaaag taaaatcagg agacgcagta aaaagaggtc aacatattgc aaatatgggt       540
     atgcaaggag agtcaacagg tgtccattta cactttgagg tttgtacaga ctttgttaat       600
     aacaggagag gaactacaaa gaaccctgaa gactacgtta atgttcgggc aagtgcttcg       660
     aaaattgagg tgaattcctt tgcaccacaa gccaagttct cagcaaaagc cgatacaaaa       720
     gaagaaggaa atgaaaaaac aatgcatcct cattacgata acgacggtgc agaactatca       780
     gaggaagaaa aactaattga tcagacgtac agaagttctt tcccatacct accggttcaa       840
     ttcatagggg attctattaa gaaaaatgat atcacaagag agttctttct tcttaatcgt       900
     gttggttggg ctagaactac caagtatgaa aaaatggttt ctttacataa ggaaagattt       960
     attcatagtg aaaaatacga tggtcatgaa ggaaatcttt attcaccaga cgcaaaaagg      1020
     ttgtttgaaa gcttgctttt gaaaacccaa aaaccttact ttgaggttat tagtggtttc      1080
     cgctttagta acgacggtca actctcaccg catgaagcag gttgtgcaat tgatatcctt      1140
     gtcaaaagta tagatgaggt tagagaaatt gcggattgtg catggctatt aggtgtgaga      1200
     tcgattgcaa ttggtggaga ttttgaaaac aacaaagggt tcattcattt agatattgct      1260
     ccaaaaggaa aagactttat gtatgatgga gtgcctatct atggtggacc aggaaagtgg      1320
     gtgactcaat ga                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page