(data stored in ACNUC9435 zone)

EMBL: CP000904.PE286

CP000904.PE286       Location/Qualifiers
FT   CDS_pept        414810..415175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5761"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5761"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46710"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY9"
FT                   /protein_id="ABY46710.1"
FT                   /translation="MNFNSQIHQSIYSKVVVPSLNRLQGTIEGYVIQVDYTKLTCEVVY
FT                   SDENSHALRTMKNVSLPKDGDGVFTQAVKNGDRVSISFKNKSKESPYISTVYKSNHSEE
FT                   NYMSPYGGRTIRQSRIF"
     atgaatttta atagtcaaat tcaccagtct atttatagta aagtagttgt accatcttta        60
     aatagattac aaggaacaat tgagggctat gtaattcaag tagactacac gaagttaaca       120
     tgtgaagtgg tttactctga tgaaaacagt catgctttgc gaacaatgaa aaacgtttct       180
     ttacctaaag atggagatgg cgtatttaca caagctgtta aaaatggtga tagggtttca       240
     atctccttta aaaacaaatc taaggagtca ccttacattt ctaccgtata taaatcaaat       300
     catagtgaag aaaattacat gagcccgtat ggtggaagaa caattagaca atcacgtatt       360
     ttttag                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page