(data stored in ACNUC9435 zone)

EMBL: CP000904.PE287

CP000904.PE287       Location/Qualifiers
FT   CDS_pept        415190..415759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5762"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5762"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46711"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUZ0"
FT                   /protein_id="ABY46711.1"
FT                   /translation="MNEAYVNKTYGDGDKDIHYPYWRQVLQSELVNFKAKSLEKELENW
FT                   QFISEDEIALKHPVTGSTFKLCDDGSIEMFVNEDTGIRLDTKENGIIFYGDSIHFATKE
FT                   MRMHTKPYGFIWNNHNLNPYLYYGDKVGEERNIPKASMVSTLQDGQANINVPLFQEQKR
FT                   KHYYDQKVTSMIEDLGIETSRIKRGG"
     atgaatgaag catatgtaaa taagacatac ggtgatggag ataaagacat tcattatcct        60
     tattggcgac aagtattgca aagtgagctc gtcaacttta aagctaaaag cttagagaag       120
     gaattagaaa actggcaatt cattagtgaa gatgaaatcg cattgaagca cccagtaaca       180
     ggatcaacct ttaaactttg tgatgatgga tctattgaaa tgtttgttaa tgaagatact       240
     ggtattcgat tagatacaaa agagaatgga atcatctttt atggtgacag tattcatttt       300
     gctacaaagg aaatgcgaat gcacaccaaa ccatacggat tcatttggaa taaccacaac       360
     ctaaatcctt atctatatta cggtgataag gtaggggaag aaagaaacat tccaaaagct       420
     tcaatggttt ctacattgca agatggacaa gcaaatatca atgttccttt attccaagaa       480
     caaaagagaa aacattatta cgaccaaaaa gttacatcca tgattgaaga tctaggaata       540
     gaaacttcaa gaataaagag aggaggataa                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page