(data stored in ACNUC9435 zone)

EMBL: CP000904.PE288

CP000904.PE288       Location/Qualifiers
FT   CDS_pept        415763..416251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5763"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5763"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46712"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUZ1"
FT                   /protein_id="ABY46712.1"
FT                   /translation="MKVDFRFSPEGDLELGSPSYNDFDELLYVDSVGNISTDSSEGLLI
FT                   RDIPLQVSYLSEKQVILNRLRTDNPDWFIHKDIGADLSELIGLPNTRETGELGKTLIEK
FT                   SLTDDKFILPADLDVRPVPVSSSEILFYITVKRKVTDLVMPVLFNLEHGLLSEYEVNS"
     atgaaagtcg attttcgttt ttcaccggaa ggagatttag agcttggttc tcctagctat        60
     aatgatttcg atgaattact ctacgttgat tctgttggca atatctcaac agatagttca       120
     gaaggtttat taataagaga tattccattg caagtatctt acttaagtga gaagcaagta       180
     atacttaaca gattaagaac agataatcca gattggttta tccataagga tattggagca       240
     gacttatctg aattaatcgg tctacccaat acaagagaga caggtgaatt aggtaaaacg       300
     ctaatcgaaa aaagcttaac agatgataag ttcatccttc cagctgactt agatgttaga       360
     ccagtccctg ttagttctag tgaaatactt ttctatataa ctgtaaaaag aaaagtaaca       420
     gatctagtta tgccagttct atttaactta gaacatggtt tgttatcaga atatgaggtg       480
     aacagttaa                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page