(data stored in ACNUC9435 zone)

EMBL: CP000904.PE289

CP000904.PE289       Location/Qualifiers
FT   CDS_pept        416251..417051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5764"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5764"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46713"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUZ2"
FT                   /protein_id="ABY46713.1"
FT                   /translation="MRKSKDEMLEDVLTRLRTDGGITETSPGSIARMFSEVMIDEFSPF
FT                   YDELELIIQMGFVSTSTGGYLDLIGELLNCTRDGDESDDNYRARISNQVSVEQNANLIA
FT                   IRLKTLRIDGVADAQFKRFTRGTGSFTCYVTPQVYPIENDLLTRVESIIDEVAAYGMNV
FT                   EVKTSEYNPVDITLNLIFHSKTTSLERQHIRNKVIQNVGAYMKQLNMGSPIIINEIIQR
FT                   VMETSEQILDMEFKKLVVNEKEYFIKNVEPSLEERYFLRKINVA"
     atgagaaaat caaaagatga aatgctcgaa gatgtattaa caagacttcg aactgatggt        60
     ggaattactg aaacaagtcc aggttccatt gctcgaatgt tttcagaagt aatgatagac       120
     gaatttagtc cattctacga tgaattagag ctaattattc agatgggctt tgtttcaaca       180
     tcaacaggtg gatacctaga ccttattggt gaactgttaa actgtactcg tgatggagat       240
     gaatcggacg acaactatcg tgcaagaatc tctaatcaag tatctgttga acagaatgca       300
     aatttaattg ctatacgttt aaaaacactg agaattgatg gcgttgcaga tgctcagttc       360
     aaaagattta caagagggac aggctcattt acttgctatg ttactcctca agtctatcca       420
     attgaaaacg acctattaac tcgtgtagaa agcattatag atgaagtagc tgcttatggt       480
     atgaatgtag aagtaaaaac aagtgagtac aaccccgttg atattaccct caacttaatt       540
     ttccactcaa aaacaacttc tcttgaaaga caacacatcc gcaacaaagt tattcaaaat       600
     gtcggagcgt acatgaagca attaaatatg ggttccccaa ttattatcaa tgaaattatt       660
     cagcgtgtaa tggaaacaag cgaacaaatt ctagatatgg aatttaaaaa acttgttgtt       720
     aatgaaaagg aatacttcat taagaatgtt gagccttcat tagaagaacg atacttctta       780
     agaaaaatta acgtagcata g                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page