(data stored in ACNUC9435 zone)

EMBL: CP000904.PE3

CP000904.PE3         Location/Qualifiers
FT   CDS_pept        2748..4931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5435"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46427"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUZ5"
FT                   /protein_id="ABY46427.1"
FT                   /translation="MAKRPEGLSPNFNSIVSPDVPSSFIFSWTFIKENSSDYQKDAEVK
FT                   VYKTGSNTALITFSSGTDNQVDITSHQGVLDPEQNYEWEVKVTAANNSTAFSGRKRFKF
FT                   GNIFLQDGLVWPDGPDAYEYIGTRKYFNEIKENAASVLEDYVIDSREENDALEKALALF
FT                   TRETVPSRTDFENLESILWLIAKKESTYQDEIQRLIEDGLGAQDIHKIYTLFDRLVKIP
FT                   PKEPSNVYLSFGGFEKLYVKEGKAYNNGKEDLSVDINWKPSDLKSGTCTINFLNELTED
FT                   VSYYRVELEVGFTDEACTHTLLYRVEDIDSLGRKIDIPMDHISFVHLSSSKETRYVLRV
FT                   YAVDKRRKQSTNYYKPYNVNNVPLGVASYNLRVQQNDLSNQWAIQYYHDIYNGPNTAYV
FT                   HNVTGNVDGIYHYAVRVFDINGSVSDWYWFPEQIKIDPLKPPSAPKPYLNWSTQTELEF
FT                   AWSAVPTAEYYEYIPTWWQNPSTQRENGLTTKHIWLNYDTTYVQKVRAVNRAGASPWVT
FT                   VSGRTKPRPIVEAYQKGAGSRTWRTDYVIYKQNGQVRKNSSEWRYEYDDNEVFHGEWVE
FT                   LRNKIQDGMAVKKGTRWGNNKCLFFLDHNDWRQKLQGKEILDVQLYIRRRNTEHGYPED
FT                   GRFLHVWAHNYAGKWDLPSGSDGPDLNNHQKIERIDFNRGESHWISLNKSFGEGLRDGW
FT                   IKGVAFYHPGADYGPYSYMRFDAYTFQFYVKYR"
     atggcaaaac gaccagaagg gttatctcct aattttaact ccatcgtttc tccagacgtt        60
     ccttcctcat tcattttttc atggacattc attaaagaaa actctagtga ttatcagaaa       120
     gatgcagaag taaaggtata taagacgggc tctaacacag cccttattac cttctcttca       180
     ggaacagata accaagtaga tataacttct caccagggtg ttcttgaccc agagcagaat       240
     tatgaatggg aagtaaaagt aacagctgct aataactcga ctgcttttag tggaagaaaa       300
     agatttaaat tcggaaatat atttctacaa gatggtcttg tgtggccaga tggaccagat       360
     gcgtacgaat acattggaac ccgcaagtac tttaatgaga ttaaagaaaa tgctgcctca       420
     gtacttgaag attacgtaat agattctaga gaagaaaacg atgcattaga aaaagctttg       480
     gctttattta ctcgtgaaac tgttcctagt cgtaccgatt ttgaaaacct cgaaagtatc       540
     ctatggttaa tcgcaaaaaa agaaagtacc tatcaagatg aaatccagag actcattgaa       600
     gatggtctag gggctcaaga tattcataag atatatacac tttttgaccg tcttgttaag       660
     atcccaccaa aagaaccaag caatgtgtat ttaagctttg gtggctttga gaagctttac       720
     gtaaaagaag gaaaagcata caacaatggc aaggaagact tatctgttga tatcaactgg       780
     aagccctcag atcttaaatc aggtacgtgt acgattaact tcttgaatga attgacagag       840
     gatgtttcgt attacagggt tgaactagag gttggtttca ctgatgaagc ttgtactcat       900
     acattacttt atcgggtaga agatatagat tcgttaggaa gaaaaattga tatcccaatg       960
     gatcacatca gctttgtaca tctttcttct tcaaaagaaa cgcgttacgt acttagagtt      1020
     tatgcagtag ataaaagacg aaaacagtca accaattatt ataaaccata taacgtaaat      1080
     aacgttcctc ttggtgtagc aagttacaat ctgcgtgttc aacagaacga cttgtcaaat      1140
     caatgggcta tccagtatta ccatgatatt tacaatggcc cgaatacagc ttatgttcat      1200
     aatgtaacag ggaatgtaga tggtatttac cattacgctg ttcgtgtatt tgatataaac      1260
     ggaagcgtta gtgattggta ttggttcccc gaacaaataa aaatcgaccc tttaaaaccc      1320
     ccttcagctc caaaaccata tttaaattgg tctactcaaa ctgaacttga atttgcttgg      1380
     tctgctgttc ctactgcaga gtattatgaa tatataccta catggtggca aaatccttca      1440
     actcaaagag agaatggtct tactacaaaa cacatatggt taaattacga tactacatat      1500
     gttcaaaaag taagagcagt aaacagagcg ggtgcatctc cttgggttac cgttagtggt      1560
     agaacaaaac caagaccaat tgttgaagca taccaaaagg gtgcaggaag cagaacttgg      1620
     cgtacagatt atgtcattta taaacaaaac ggacaagtta gaaaaaattc gtcagagtgg      1680
     cgctatgaat acgacgataa cgaagtattt catggagaat gggtagagct tcgaaacaag      1740
     attcaagatg gtatggccgt taaaaaagga acaagatggg gcaataacaa atgtttattc      1800
     ttccttgacc acaatgattg gagacaaaaa ttgcagggaa aagagatttt ggacgttcag      1860
     ctttatattc gtagaagaaa taccgaacac ggatatccgg aagatggtcg tttccttcat      1920
     gtatgggcgc acaattatgc aggaaaatgg gatctgcctt caggatcgga tggtcctgat      1980
     ttaaacaatc accaaaagat agaaagaata gactttaatc gaggtgagtc tcactggatt      2040
     tctcttaata agtcgtttgg tgaaggtcta cgcgacgggt ggatcaaagg ggttgcattt      2100
     tatcatcctg gtgcagatta tggtccatac tcttacatgc gttttgacgc ttatacattc      2160
     caattttacg taaaatatcg atag                                             2184
//

If you have problems or comments...

PBIL Back to PBIL home page