(data stored in ACNUC9435 zone)

EMBL: CP000904.PE32

CP000904.PE32        Location/Qualifiers
FT   CDS_pept        53323..54732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5465"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bsu:BG12750 similar to histidine permease"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5465"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46456"
FT                   /db_xref="GOA:A9VV24"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV24"
FT                   /protein_id="ABY46456.1"
FT                   /translation="MENKNGREFQRKMQARHLVMLSLGGVIGTGLFLSSGYTIQQAGPF
FT                   GTILSYLIGALVVYLVMLCLGELSVHMPETGAFHSYAVKYIGPGTGYTVAWLYWLTWTV
FT                   ALGSEFTAAGLLMKRWFPSINVWVWSALFAILIFVLNVLTVKFFAESEFWFSSIKVIAI
FT                   VIFIVLGVAAMLGFLPMTHSKAAPFFSNFTSGGLFPHGATAIIMTMLAVNFAFSGTELI
FT                   GIAAGETANPEKMIPKAIRTTLWRLIIFFVGTIVVLSALLPISDAGVLESPFVAVLERI
FT                   GVPYSADIMNFVILTAILSAANSGLYASSRMLWSLANKNTISPIFGKMTKQGIPINAVI
FT                   FSMVGGALALLSSIVAPDTVYIVLVSISGLAVVVVWMSISASQFLFRRQFLKEGNSEKD
FT                   LIYRTPLYPLVPIASFILCLASCIGIAFDPTQRIALYCCIPFILFCYGSYYLTKNLKKR
FT                   GVDYVEQNQPN"
     atggagaaca aaaatgggcg agaatttcaa aggaaaatgc aagcacgtca tttagtgatg        60
     ctatcacttg gtggggtgat tggaactggc ttattcttaa gctcgggtta cactattcaa       120
     caagctggcc cgtttggaac aattctatct tatctgattg gtgcgctagt ggtttatcta       180
     gttatgctat gtttaggaga gctttccgta catatgcctg aaacgggcgc atttcatagt       240
     tatgcagtta aatacattgg accgggtaca gggtatacag tagcctggtt gtattggtta       300
     acttggactg ttgctttagg ttctgaattt acagccgcag gattacttat gaagcgatgg       360
     tttccatcaa ttaatgtttg ggtatggagt gctctttttg ccattttgat ctttgtatta       420
     aatgtcctga ctgttaaatt tttcgccgaa tccgaatttt ggttttcatc gataaaggtt       480
     atagctattg tgatttttat tgttttagga gtagcggcaa tgctagggtt tcttccgatg       540
     actcattcaa aagcagcacc attcttttct aattttacaa gtggaggttt atttcctcat       600
     ggtgctacgg ccattataat gaccatgctt gcggttaatt ttgctttttc gggaacagaa       660
     ttaataggca ttgcagctgg agaaacagcg aacccggaaa aaatgatacc gaaggccatt       720
     cgaactactc tgtggagatt gataatcttt tttgtaggaa caattgttgt tttatctgcg       780
     ttattgccta tttccgatgc aggggtatta gagagccctt ttgttgcagt tctagaacga       840
     attggggtgc catattcagc tgacataatg aatttcgtta tcttaacagc cattttatct       900
     gcggcaaact caggccttta tgcctcttct agaatgcttt ggtcgcttgc taataagaat       960
     acgatatccc cgatttttgg aaaaatgacg aagcaaggta ttccaatcaa cgccgtcatt      1020
     ttcagcatgg tgggtggagc cttggctttg ctctcaagta ttgtggcacc agatactgtc      1080
     tatatcgtac ttgtttccat ttccggtcta gcagtagttg tagtttggat gagtattagt      1140
     gcttcccagt tcctatttcg cagacaattt ttgaaagaag gaaattctga aaaggacttg      1200
     atttatcgca caccactata tccattagta ccaattgctt cttttatcct ttgtctggca      1260
     tcgtgtattg gaattgcatt cgatccaaca cagagaattg ccttatattg ctgcataccg      1320
     tttattttgt tttgctatgg aagttattat ctaacaaaaa atcttaaaaa gaggggcgta      1380
     gattatgtcg aacaaaacca acccaattga                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page