(data stored in ACNUC9435 zone)

EMBL: CP000904.PE34

CP000904.PE34        Location/Qualifiers
FT   CDS_pept        56801..58402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5468"
FT                   /product="N-acetylmuramoyl-L-alanine amidase family 2"
FT                   /note="PFAM: S-layer domain protein;
FT                   N-acetylmuramoyl-L-alanine amidase family 2; SH3 type 3
FT                   domain protein; SMART: SH3 domain protein; KEGG:
FT                   btk:BT9727_3111 N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5468"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46458"
FT                   /db_xref="GOA:A9VV26"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV26"
FT                   /protein_id="ABY46458.1"
FT                   /translation="MNIRFNKKVVAFTAGLTVLSSPLVSFAEEQQLVNNKQPTNVQEQS
FT                   KTTSDEQALKSIEASFEEVDGRGGGTVDNKKVDSLQRSEGIHEETGTLTVPNNSNRTKR
FT                   SLSPISPSTSSTINGVPFTEWIVPAGNDNIRPQNYMSPKYITIHETDNTSVGAGARNHA
FT                   QYLYNQAVGNTDRAASWHFTVDDKEIYQHLPLNENGWHAGDGDGPGNRESIAIEIAVNS
FT                   DGNYSKAVDNAKKLVAYLMKETGVPLNNIVKHQRWSGKICPANMINNGQWDAFVNGVGG
FT                   YYNNLYQPKDDITGGWYEEAIRELNRRGIMIGEGNGVFAPNRAITRAEFAQLISKSLNL
FT                   PAGDASFKDLNDANSTLRDGIKRAASAGIILGRGDGYFDPNTPITREESAIIVNKALQY
FT                   KGIWGPVVNLPFSDKDQISYKEDVQRLYGLGIVRGKGDNQYDPKGTTTRGETATFILNM
FT                   LQVIENGSVEKVIGTAQINGIGVNVRSGSGTNYSIVRKTSKGEKVTVYEEKNGWLRIGT
FT                   GQWIYYDSSYIDYNRL"
     atgaacatta gatttaataa aaaagtagta gcattcacgg caggattaac ggtattatct        60
     tcaccattgg tatcgtttgc agaggaacaa caattagtaa acaataagca acctacaaac       120
     gttcaggaac aaagtaaaac aacatcagat gaacaggctt taaaaagtat tgaagctagt       180
     tttgaagagg tagacggacg tggtggaggt actgtcgaca ataagaaagt agatagtctt       240
     caacgttcag aaggtattca tgaagaaaca ggtacactaa ctgttcctaa caattcaaac       300
     agaacaaaac gtagtctgtc tcccatatca cctagcacct ctagtacaat aaatggtgtt       360
     ccattcactg aatggattgt tccagcaggt aacgataata ttcgtcctca aaactatatg       420
     agtccaaagt acattacaat tcatgagact gataatacaa gtgtaggagc aggtgctaga       480
     aaccacgccc aatacctata taaccaagca gtaggcaaca cagaccgagc tgcatcgtgg       540
     cattttacag tagacgataa agagatttat caacatctac cattaaacga gaacggatgg       600
     cacgcaggag acggtgatgg tccaggtaat agagaatcta ttgcaattga aatcgcagtt       660
     aacagtgacg gtaattatag taaagcggta gataatgcta agaaacttgt agcttattta       720
     atgaaagaaa ctggtgtacc gttaaataac attgtaaaac accaaagatg gagtggtaaa       780
     atatgtcctg ctaatatgat taataatgga caatgggatg cattcgtaaa tggtgttggt       840
     gggtattata ataatcttta tcaaccaaaa gatgacatta ctggaggttg gtatgaagaa       900
     gctatacgag agttaaatag aaggggtatt atgatagggg aaggaaacgg agttttcgca       960
     cctaatagag cgataacaag agccgaattt gctcaattaa tctctaaatc tctaaacctg      1020
     ccagctggag atgcttcatt taaagaccta aacgatgcaa actcaacttt acgagatggt      1080
     attaaacgtg ctgcaagtgc aggtattatt ctaggtagag gtgatggtta ttttgaccca      1140
     aacacaccta ttacaagaga agaatcagca attattgtaa acaaggcttt acagtataaa      1200
     ggtatatggg gaccagttgt aaacctacca ttctcagaca aagaccaaat tagctataaa      1260
     gaagacgtac aaagattgta tggcctaggt attgtaagag gtaagggtga caatcaatac      1320
     gaccctaaag gaacaacaac tcgtggtgaa acagcaacat ttattctaaa tatgctacaa      1380
     gtaattgaaa atggtagtgt tgaaaaggta attggaacgg ctcaaattaa tggtattggg      1440
     gtaaatgttc gaagcggatc aggtacaaac tattctattg ttagaaagac aagtaaaggc      1500
     gaaaaagtta cagtatatga agaaaagaat ggttggctaa gaattggaac aggtcagtgg      1560
     atttattatg actctagtta tatcgactat aacagattat aa                         1602
//

If you have problems or comments...

PBIL Back to PBIL home page