(data stored in ACNUC9435 zone)

EMBL: CP000904.PE35

CP000904.PE35        Location/Qualifiers
FT   CDS_pept        59163..60353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5469"
FT                   /product="2-alkenal reductase"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: bcy:Bcer98_2249 2-alkenal reductase; PFAM:
FT                   peptidase S1 and S6 chymotrypsin/Hap; SMART: PDZ/DHR/GLGF
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5469"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46459"
FT                   /db_xref="GOA:A9VV27"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV27"
FT                   /protein_id="ABY46459.1"
FT                   /translation="MGHYDTKQTRKNKSRDGKKTGYFFIGIIGAMIGSITIGLTTPYID
FT                   EIKGSTGQSAKNNEVNQVTPISHKPEGVNSLQNMIEDAKEVVVGVINYKQNADSFNTQD
FT                   QSEEAGSGSGVIYKKNGNKAFIVTNNHVIDGANKVEVKLNNGKKVPAKVVGTDSLLDLA
FT                   VLEIDGTDVKRVATLGDSDKNRTGETVIAIGNPLGLEGSVTKGIISSKEREIPVSTLGN
FT                   QQVDWQAQVIQTDAAINPGNSGGALFNEQGEVIGINSSKIAQQAVEGIGFAIPINIAKT
FT                   TLGFLEKDGTVKRPMMGVQLLDVEKMTDSARNQLKLPKEISNGAVLGNISNQSPAEKGG
FT                   LQQHDVVIALDEQKIENVVQFRKYLYEKKKSGDTIKVTVYRNGEKITKMVKLTEQK"
     atgggacact atgatacaaa acaaacaaga aagaacaaaa gtagagacgg taaaaaaact        60
     ggttattttt ttattggaat aattggtgca atgatcgggt caattactat tggcttgacc       120
     actccatata tagatgagat caaaggaagt acaggtcaat ccgctaaaaa taacgaggtg       180
     aatcaggtta ctcctatctc gcacaaacca gaaggtgtga atagtcttca aaatatgatt       240
     gaagatgcaa aagaagttgt agtaggtgtc attaactata aacaaaatgc agattcattt       300
     aatacgcaag accaatcaga agaagctggt tcgggatcag gggtcatata taaaaaaaac       360
     ggcaataagg ctttcattgt tacaaataat catgtgatag acggtgcgaa taaagtagaa       420
     gtgaaattga ataacggtaa aaaggttccc gctaaagtag tagggacaga ttcattatta       480
     gatttagcgg tattagaaat tgacggaact gatgtaaaaa gagtcgcaac acttggagac       540
     tcagataaaa atcgtacagg ggaaacggta atagccattg ggaatccatt ggggctagaa       600
     ggaagtgtaa caaaggggat tattagtagc aaagaacgag aaatacctgt tagtacactt       660
     ggaaatcaac aagtggattg gcaagcacag gtaattcaaa cagatgcagc tattaatcct       720
     gggaatagcg gaggagcttt gtttaatgaa caaggtgaag tcattggaat taattcgagt       780
     aaaattgcac aacaagcagt tgaaggaatt ggatttgcaa tcccaattaa tatagccaaa       840
     acaaccctag ggtttcttga gaaagatgga acagttaaac gtccaatgat gggtgtacag       900
     ttattagatg tagagaaaat gacagattct gcacgtaatc aattaaaatt accaaaagag       960
     atatcaaatg gtgcagtatt gggaaatatc tcaaaccaat caccagcaga aaaaggagga      1020
     ttacagcagc atgatgttgt gattgcattg gatgaacaaa aaatagaaaa cgttgttcaa      1080
     ttccgcaagt atttatatga aaagaaaaaa tcgggggata caattaaagt gacagtttac      1140
     cgcaatggtg aaaaaataac aaaaatggtg aaattaacag agcaaaagta g               1191
//

If you have problems or comments...

PBIL Back to PBIL home page