(data stored in ACNUC9435 zone)

EMBL: CP000904.PE36

CP000904.PE36        Location/Qualifiers
FT   CDS_pept        complement(60579..61982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5470"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: bca:BCE_2750 histidine
FT                   kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5470"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46460"
FT                   /db_xref="GOA:A9VV28"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV28"
FT                   /protein_id="ABY46460.1"
FT                   /translation="MKMKRITYKLFMTTSLILLAFAVMIYLTLYFFLPTFYEQYKTEQL
FT                   ENGMEEIIDKSKNLTFQNAQPLFEEYMQKNNAILRFPDYERVSVYSTPYTFIQGSVTQA
FT                   ARIGGSNSLNKSYDIPFQDGNQTVIVYATFQPIDEASKVLVRFLPYISIIVVVIGIGSA
FT                   YLFSRFITKPLIYINRGAQKMADLDFSEKIEIRSMDELGELSNSLNDMSINLQQTMFDL
FT                   QKANQQLKSDIEKEREIETKRREFFATVSHELKTPLTIMKGYLEGMIYNIGPYQDRDQY
FT                   LKKNHQIIEKMENLVREILSMSKLEQHTFKLQLKEINLSELMDIITKDLSFFASQKDIQ
FT                   IIKQIDSNLSVYTDRALLEKACKNIIHNAIMYSPNSENVYIQLTQDSKQKCILIQIINT
FT                   GVQIKENDIQHVFEPFYRIEKSRNRNTGGSGLGLYIVKQIFEALGIEYCINNVEQGVQF
FT                   VVSIPISEQ"
     atgaaaatga agcgaattac ttataaactt tttatgacta catccctcat tttgttagcc        60
     tttgcagtca tgatttattt aactttatac ttttttcttc ctacatttta tgaacaatat       120
     aaaacagagc agcttgaaaa cggaatggaa gaaataattg ataaatctaa gaatcttact       180
     tttcaaaatg cacaaccgct ttttgaggag tatatgcaaa aaaataatgc aatactcaga       240
     tttccagatt acgaaagagt aagcgtttat tctactcctt atacatttat tcaaggaagt       300
     gttactcaag cagcacgaat agggggttca aatagcctga acaaatcata tgatattcca       360
     tttcaggatg gtaaccaaac cgtcatagta tacgcaacat ttcaacctat tgatgaggct       420
     tccaaagttt tggtacgttt ccttccctat atcagtatta ttgtagttgt tattgggata       480
     ggaagtgctt atttattttc aaggttcatt acaaagccac tcatttatat taatcgaggg       540
     gcacaaaaaa tggcggactt agacttttcc gaaaaaattg agattcgttc tatggatgaa       600
     ttaggggaac tatctaatag cttgaatgat atgtccatta atttacaaca aactatgttt       660
     gatttacaaa aagcaaatca gcaattaaaa agtgatattg aaaaagaaag agaaatagaa       720
     acaaaacgca gagaattttt tgcaactgta tcacatgaat taaaaacccc tctcactatt       780
     atgaaaggat acttagaggg gatgatatat aatattggtc cttatcaaga tcgtgaccaa       840
     tacttaaaga aaaaccacca aattatcgaa aagatggaaa atctagttcg tgagatttta       900
     agtatgtcta aattagaaca acatacattt aaactacaat taaaagaaat aaatctctcc       960
     gagttaatgg atataatcac aaaagatctc agtttttttg cttctcaaaa agacattcaa      1020
     atcataaaac agattgattc taacctttct gtctatacag atcgggctct tttagaaaaa      1080
     gcctgtaaaa atattattca taatgcaatt atgtattctc cgaatagcga gaatgtatat      1140
     atacagctaa ctcaggactc aaaacaaaaa tgtatcttaa ttcaaattat caatacaggt      1200
     gtacaaatta aagaaaatga tatacaacat gtctttgaac cattttatcg aattgaaaag      1260
     tcaagaaatc gaaatactgg tgggagtggc ttaggattat atattgtaaa acaaattttt      1320
     gaagcactag gtatagagta ctgtattaat aatgtagaac aaggtgtaca atttgttgtt      1380
     agtattccaa tatctgaaca ataa                                             1404
//

If you have problems or comments...

PBIL Back to PBIL home page