(data stored in ACNUC9435 zone)

EMBL: CP000904.PE37

CP000904.PE37        Location/Qualifiers
FT   CDS_pept        complement(61996..62661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5471"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bca:BCE_2749 transcription
FT                   response regulator-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5471"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46461"
FT                   /db_xref="GOA:A9VV29"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV29"
FT                   /protein_id="ABY46461.1"
FT                   /translation="MINHHILVIEDDQEIQELIKQFLLTQQYTVEVASDGLEGMIQFNK
FT                   QSFDLILLDVMMPNLNGFEVAKMIRSQSNVPVIMLTALEEEQDQMKGFDLGIDDYITKP
FT                   FSFHVLIRRVEAVLRRSNDKSLDNHFVFKELRVDVDAYKVYVNEVEISLTTKEFEILQL
FT                   LLQNEKRVLPRESIVEKVWGYDYIGESRIIDTHMKNIRKKLDIPYIKTIKGIGYKIDE"
     atgatcaacc atcatattct tgtaatagaa gacgaccaag aaattcagga attaattaaa        60
     caatttttat tgacacaaca gtatacagtt gaagttgcat cagatggatt agaaggaatg       120
     atacaattta ataagcaatc ctttgatttg attcttttgg atgtgatgat gccaaacctt       180
     aacggatttg aagttgcgaa aatgattcga agtcaatcaa atgtgccagt tattatgctg       240
     actgcgttag aagaagaaca agatcaaatg aaaggatttg atcttggaat cgatgattat       300
     attacaaaac cattctcttt tcatgttttg attagacgag tcgaagcagt actaagaaga       360
     agcaatgata aaagcttaga taatcatttc gtctttaaag aattgcgtgt cgatgtcgac       420
     gcctataaag tatatgtaaa tgaagttgaa atctccttaa caacgaaaga attcgaaatt       480
     ctgcaactac tacttcaaaa tgagaaaaga gtactcccaa gagaaagcat cgtagaaaaa       540
     gtttggggat acgattatat tggagaatca cgaataattg atacacatat gaaaaacata       600
     cgaaaaaaat tagatatccc atacattaaa acaataaaag gcattggtta taaaatcgat       660
     gaatag                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page