(data stored in ACNUC9435 zone)

EMBL: CP000904.PE38

CP000904.PE38        Location/Qualifiers
FT   CDS_pept        64534..66897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5472"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; Carbohydrate-binding family V/XII; Fibronectin
FT                   type III domain protein; KEGG: btl:BALH_3389 serine
FT                   protease, subtilase family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5472"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46462"
FT                   /db_xref="GOA:A9VV30"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR004954"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034073"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV30"
FT                   /protein_id="ABY46462.1"
FT                   /translation="MKFIKGIFVSTIALTAFTGLELIKFHENPNVVYADSKGPVKNISQ
FT                   SEADIKEEDQIIVKFKSEVNFPYKDGLEKQIKNEDSDLELVKIFSEFPQLTLKRLFTSV
FT                   DPKEIENIDKHTRETENNSSSNLLDYYIVEVPNKVTAETLMDKFKKSYLVEEVYMQEKP
FT                   TLLPEVQLPTVSLNPYDDPRFLNQGYLKEAPYGINASYAWSIKGGDGKGTTFVDMEYGW
FT                   LLDHEDLVNQKVELISGRNIDQHVGHGTSVLGIVSAEDNKVGNIGIASKAKVKVVSQIR
FT                   GDGSYNTADAIINAVHNLQAGDILLLEAQASYDGYGDKYLPVEVQPDIFDAIRAGTDKG
FT                   IIVIEAGANGSNDLDQFRDRNGKQVLNRNSPDFKDSGAIMIGAASSTVPHKRLWFSNYG
FT                   SRIDVYGWGENVDTTRAEPNRITKNLYTTGFSGTSSASPIIAGAATSIQGVAKEHLGRP
FT                   YKPAELRNILSNPNTGTKSQNPLTDKIGVLPDLKSILSNLGYSPDISNNVLEGNQFVWS
FT                   MKGIGDFEFAKLDFNKTKEEMQIQLKAGVPHHYFDSTYASVKVQNSSGKVVYNKDIYGN
FT                   RQQNAETQKISMKVGDYIEFTHLEGGNRATLINVDKNIQESFGKKIVYQVTVNGLKKVD
FT                   QIINPSPDTEAPTRPEGLQAANITANSVELKWNSSTDNVGVKEYQVLRDGKFIQMVQGT
FT                   TFTDSKLTANIEYKYTVKAIDAAGNQSIQSSVLSIKTKEQNTSYEKWDPRKAYTKGDRV
FT                   EYQGKIYEAVQSYQGNGDSNWIFSLSLWKTISIS"
     atgaaattta taaaagggat atttgtttct acgattgcac ttacggcctt tacaggatta        60
     gagctaatta aatttcatga aaatcccaat gtagtgtatg cagattcgaa aggtcctgta       120
     aaaaatataa gtcaatctga ggcagatatt aaagaagaag atcaaattat tgtaaagttt       180
     aaaagtgaag tgaatttccc gtataaggat ggacttgaaa aacaaataaa aaacgaagat       240
     agcgatctgg aattagtaaa aatcttttct gaatttccac agctaacatt aaaacgttta       300
     tttacatctg tggacccaaa agagattgaa aacatcgata aacatacgag ggaaactgaa       360
     aataattcat cttctaattt actagattat tatattgtag aagtgcctaa taaagtaaca       420
     gctgaaacat tgatggacaa gtttaagaaa tcttatcttg ttgaagaagt atatatgcaa       480
     gaaaaaccaa ctcttttacc agaagtacaa ttacctactg tatcgcttaa cccttacgac       540
     gatccaagat ttttaaacca gggatatctt aaggaagcac catatgggat taatgcatct       600
     tatgcatgga gcattaaagg tggagatgga aaaggaacta cttttgtaga tatggagtat       660
     gggtggttat tagaccatga agatttagta aatcaaaaag ttgagcttat atctggtaga       720
     aatatagatc aacacgttgg gcacggaaca tccgttcttg ggattgtttc tgctgaagat       780
     aataaggttg gtaacatagg aattgcatcg aaggctaagg ttaaagtagt atcccaaata       840
     agaggtgatg ggtcgtataa tacggctgat gcgataataa atgctgtaca taatttgcaa       900
     gctggggata ttttattatt agaggcacaa gcttcttatg atggatatgg agataaatat       960
     ttacctgttg aagtacagcc agatatcttt gatgcaatac gagctggaac ggataaagga      1020
     attattgtga tagaagctgg ggcaaatggt tctaatgacc ttgatcaatt tagagatcgg      1080
     aatggaaaac aggtattaaa tcgcaatagt ccggacttta aagattcagg agctataatg      1140
     attggagccg catcgtcaac tgttcctcat aaacgtttat ggttttcaaa ttatggtagt      1200
     agaattgatg tttatggttg gggagaaaac gtagatacaa ctcgtgctga gcctaatagg      1260
     attactaaaa atctctatac aacaggcttt agtggtacat ctagtgcttc tccaattatc      1320
     gctggagcag cgacttcaat acaaggtgtg gctaaagaac atttaggtcg tccatataaa      1380
     ccagctgaat taagaaatat acttagtaat ccaaatacag gtaccaaatc tcaaaatccg      1440
     ttaacagata aaatcggtgt tttgccagat ttaaagtcaa tcctgtcaaa tttgggatat      1500
     agtccagata tatcaaataa tgttttagag ggaaaccaat ttgtatggtc aatgaaagga      1560
     ataggagatt ttgagtttgc aaaattggat tttaataaga caaaagaaga aatgcaaatt      1620
     caattaaaag caggtgtacc acatcattac tttgatagta catatgcgag tgtgaaagtc      1680
     caaaattcat ctggaaaagt ggtatataat aaagatattt atggaaacag gcaacaaaat      1740
     gctgaaacac aaaaaatttc gatgaaagtc ggagactata ttgagtttac acatttagag      1800
     ggtggaaacc gggcgactct tataaatgtg gataaaaata tacaggagag ctttggtaag      1860
     aagatagtgt atcaagttac agttaatggt cttaagaaag ttgatcaaat tattaaccct      1920
     agcccagata cggaagctcc tacacggcct gaaggattac aagcagccaa cattactgca      1980
     aatagcgtag agttaaaatg gaattcatca acagataacg taggtgtgaa agaatatcaa      2040
     gtattacgtg acgggaaatt cattcaaatg gtacagggaa ccacatttac tgatagtaaa      2100
     ctgactgcta acatagaata caaatatact gtgaaggcta tagatgcagc tggaaatcag      2160
     tctattcaaa gtagtgttct tagtataaaa acaaaagagc aaaatacctc ttatgaaaaa      2220
     tgggatccga ggaaagcata tacaaaaggg gatagagtag agtatcaagg gaaaatctat      2280
     gaagctgttc aaagttacca aggaaatgga gattcgaatt ggatattctc gttatcctta      2340
     tggaaaacaa tttcaataag ttga                                             2364
//

If you have problems or comments...

PBIL Back to PBIL home page