(data stored in ACNUC9435 zone)

EMBL: CP000904.PE39

CP000904.PE39        Location/Qualifiers
FT   CDS_pept        67752..68225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5473"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0277 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5473"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46463"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV31"
FT                   /protein_id="ABY46463.1"
FT                   /translation="MKTFGKILLTGTLALGGLTVMNVETPKAQAEGASEFCRYICGPKE
FT                   TLNNFTIQLSDTEYRMGQNIILRATNDNAYDVTYKATVEKQYATGWGYVETDFNYQSML
FT                   PAGTNEDFNVWTFDGNSAGNLNEAGTYRMKIEVTHADGKTDTVYTAPITLLAQ"
     atgaaaacat ttggaaaaat attgttaaca gggactttag ctcttggtgg attaacagta        60
     atgaacgtgg aaacacctaa agctcaagca gagggagcga gcgaattttg ccgatatatt       120
     tgtggtccta aagaaacatt gaacaatttt acaattcaac tttcagatac ggaatacaga       180
     atgggacaaa atattatcct acgcgcaaca aatgataacg catatgatgt aacatacaaa       240
     gcaactgtag aaaaacaata tgctactggc tggggttatg ttgaaactga ctttaattat       300
     caatcaatgt tgccagctgg aacaaatgaa gatttcaatg tttggacttt tgacggtaac       360
     agcgcaggta atttgaatga ggcaggaaca tatcgcatga aaattgaagt aacacatgct       420
     gatgggaaaa ctgacacagt ttacactgcg ccaattacat tattagcaca ataa             474
//

If you have problems or comments...

PBIL Back to PBIL home page