(data stored in ACNUC9435 zone)

EMBL: CP000904.PE40

CP000904.PE40        Location/Qualifiers
FT   CDS_pept        complement(68554..68745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5474"
FT                   /product="group-specific protein"
FT                   /note="KEGG: bcz:BCZK3444 group-specific protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5474"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46464"
FT                   /db_xref="GOA:A9VV32"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV32"
FT                   /protein_id="ABY46464.1"
FT                   /translation="MIKSLQTFWGCLAFGVLTFAIFLIIGLTDTPFNALGWRDWLGSVV
FT                   GAAIISTGMFTLKKLNLK"
     atgataaaat ctttacaaac attttgggga tgcttagcat tcggtgtatt gacgtttgct        60
     atcttcttaa ttataggctt aacagataca ccttttaatg ccttaggttg gagagactgg       120
     ttaggttctg tagttggtgc agccattata tcaactggaa tgtttacttt aaagaaatta       180
     aatttaaaat aa                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page