(data stored in ACNUC9435 zone)

EMBL: CP000904.PE42

CP000904.PE42        Location/Qualifiers
FT   CDS_pept        complement(69198..69611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5476"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0275 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5476"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46466"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV34"
FT                   /protein_id="ABY46466.1"
FT                   /translation="MKKVILAGALGIAVLSGMNLPGVEATKASAASTNLEIQEITKYYS
FT                   MSSYEVSQKESFNLKKGEELTVFITNSGFPISYTVFDADNQVIGTYNANSPYGRVFTAQ
FT                   KDGNISVQFQAGANSSFMKKMNFTAKFALSKLN"
     atgaaaaaag tcattttagc aggcgcatta ggaattgcag tactttcagg tatgaattta        60
     ccaggggtag aagcaacaaa agcgagtgca gcatctacga atttagaaat tcaagagatt       120
     acaaaatatt actctatgag ttcttatgaa gtgtctcaaa aggaatcttt taaccttaaa       180
     aagggtgaag aacttactgt ctttataaca aattcaggat tcccaatctc ttatacagtc       240
     tttgacgcag ataaccaagt aattggcaca tacaatgcta attcgccata tggccgcgta       300
     tttacagcac aaaaagatgg taatatttca gtacaattcc aagcaggtgc aaattcttcg       360
     ttcatgaaaa aaatgaattt tacagctaaa tttgctcttt ctaaattaaa ttaa             414
//

If you have problems or comments...

PBIL Back to PBIL home page