(data stored in ACNUC9435 zone)

EMBL: CP000904.PE43

CP000904.PE43        Location/Qualifiers
FT   CDS_pept        complement(70268..71362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5477"
FT                   /product="tetratricopeptide domain protein"
FT                   /note="KEGG: bcy:Bcer98_0992 tetratricopeptide domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5477"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46467"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR040702"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV35"
FT                   /protein_id="ABY46467.1"
FT                   /translation="MNVQIKGNEQITHLLNEWYQEIRARHVDAAHLLKQEIENKIHDIE
FT                   ENQTILLYYSLLDFRHQYLIDSLSISKDSFKKSDAYETPTDDFLSYYYHFFKAIHSNVM
FT                   GNHSLARIHFDKAESLLSTIPDEIEYAEFHYELAVFYCHTHKSILCINHVMKAKDIFSK
FT                   HMGYELKVAFCNNLYGLACTHLREWELAEEHYISAMDTFQKENLEYNILIVRHNLGFMY
FT                   ATQNLSELALRYLSEVNQKLASDYKALFIEAREHYKLGENQIAQELIEKGLQLSTQLGI
FT                   ESYIHHFNILKKMNLNSCAIDVEKAILEGISYFEREELYEYINEYTEKLATQFYKENNH
FT                   VKASYYFYEASKASEKNYIKGALK"
     atgaatgttc aaataaaggg gaacgaacaa ataactcatt tattaaatga atggtatcaa        60
     gaaattagag ctaggcatgt agacgccgct cacttactta agcaagaaat tgaaaacaaa       120
     atccacgata tagaagaaaa tcaaaccata ctattatact actcacttct agattttaga       180
     caccaatatc taattgatag tttgagtatt tctaaagata gttttaaaaa aagtgatgct       240
     tacgagactc ctacggatga cttcctttca tactattatc acttctttaa agcaatccac       300
     tcaaatgtta tgggtaatca tagtcttgca agaatacatt ttgataaagc tgaaagttta       360
     ttatcgacaa tacctgacga aatcgaatac gctgaatttc attatgaatt ggctgttttc       420
     tactgccata cacataaatc aatcctatgt attaatcatg ttatgaaagc taaagatatt       480
     ttttcaaaac acatgggata tgaattaaaa gttgcctttt gcaataactt atacgggctg       540
     gcatgtactc atttaagaga atgggaatta gcagaggaac attatatttc agcgatggat       600
     acattccaga aagaaaattt agaatacaat attttaattg tccgtcataa cctaggattt       660
     atgtatgcta cacaaaacct ctctgagtta gcattacgat atttatctga ggttaatcaa       720
     aagctagcca gtgattataa agctttattt attgaggcaa gagaacatta taaattagga       780
     gaaaatcaaa tagctcaaga gctaatcgaa aaagggctac aactttccac tcagttaggt       840
     atcgaaagtt atatacatca ctttaatatt ttgaaaaaaa tgaacctaaa tagttgtgca       900
     attgatgtag aaaaagctat cttagaagga atttcctatt ttgaacgcga agaactatat       960
     gaatatataa atgaatatac tgaaaaatta gcaacccaat tttacaaaga aaataatcat      1020
     gtaaaagcaa gctattactt ttatgaagct agcaaagcca gtgaaaaaaa ctatataaaa      1080
     ggagcattaa aatga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page