(data stored in ACNUC9435 zone)

EMBL: CP000904.PE44

CP000904.PE44        Location/Qualifiers
FT   CDS_pept        71671..71964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5478"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: bcy:Bcer98_1906
FT                   regulatory protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5478"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46468"
FT                   /db_xref="GOA:A9VV36"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV36"
FT                   /protein_id="ABY46468.1"
FT                   /translation="MIALKNDRNVKEISEENVDLLKVMAHPVRLQIVNELMHHKKCNVT
FT                   QLTEILRLPQSTVSQHLSKLRRTVLRTERRGLEVHYYIDNAKARQIVGILGL"
     atgatagcat taaaaaatga tcgaaatgta aaagaaattt cggaagagaa cgtagattta        60
     ttaaaggtta tggcgcatcc agtacgatta caaattgtaa atgaattaat gcatcataaa       120
     aaatgcaatg ttacacagtt aacggaaata ttaagactcc ctcaatccac tgtttcacag       180
     catttatcaa aattgagaag aaccgtactc cgtacagaaa gaagaggatt agaggtgcat       240
     tattatattg ataatgctaa agctcgtcag attgtaggaa ttttgggttt gtag             294
//

If you have problems or comments...

PBIL Back to PBIL home page