(data stored in ACNUC9435 zone)

EMBL: CP000904.PE46

CP000904.PE46        Location/Qualifiers
FT   CDS_pept        73493..74314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5480"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bcz:pE33L466_0280 possible Zn-dependent hydrolase,
FT                   including glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5480"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46470"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV38"
FT                   /protein_id="ABY46470.1"
FT                   /translation="MFKTIDTNLNDVKLTVFSSDEKSFMVTATLVEKAGHAFLINSKFT
FT                   QSDSKEIVDYLKNNNLSLDKIFIIHGDPDYYFGLESIKAAYPGAIAYATESTVEHIVHS
FT                   VLGKLKVWKDVLGENAPNNVVLPQVIKEKTIDFQGLTFELVGLDDYRTSLFNKELKLLI
FT                   GGIDVFNEIHVFLADTSSKAAMEAWIENLKVLQALNADIIVPSHGSIEKSLDNQAIIAT
FT                   MDYLRTAIQASEESKTSKDFVAKLETAYPGYANKGVLELSAKVVTKEMPWG"
     atgtttaaaa caatcgatac aaatctaaat gatgtaaaat tgacggtgtt tagttcggat        60
     gaaaaaagtt ttatggtaac tgcaacctta gttgagaaag caggacatgc atttttaata       120
     aactcaaaat ttactcaatc tgattcgaaa gaaattgtgg attatctgaa aaacaataac       180
     ttatccctag ataaaatctt tattatacat ggggatcctg attattactt tgggttagaa       240
     agtattaaag ctgcttaccc aggagccata gcgtatgcaa cagagtctac tgttgaacat       300
     attgttcatt ctgtattagg gaaattaaaa gtttggaaag atgtactagg agaaaatgca       360
     ccaaacaatg tggtattacc tcaagttatt aaagagaaaa caattgattt tcaaggttta       420
     acatttgaac ttgtaggctt agatgattac agaactagct tatttaataa agagctaaaa       480
     ttattgattg gaggcattga tgtatttaac gaaatccatg tgttcttagc agatactagc       540
     tcaaaagcag caatggaggc atggattgag aacttgaaag tattacaagc gttaaatgct       600
     gacattattg taccaagcca tggatcaatc gaaaaatcct tagataatca agcgattatt       660
     gcaactatgg attatctaag aactgcaatt caagcttctg aggaaagtaa aacttcaaaa       720
     gattttgtag caaaacttga aacagcatat ccaggctatg ctaataaagg tgtattggaa       780
     ttaagtgcaa aagttgtaac aaaagaaatg ccatggggtt aa                          822
//

If you have problems or comments...

PBIL Back to PBIL home page