(data stored in ACNUC9435 zone)

EMBL: CP000904.PE47

CP000904.PE47        Location/Qualifiers
FT   CDS_pept        74319..74711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5481"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5481"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46471"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV39"
FT                   /protein_id="ABY46471.1"
FT                   /translation="MNKYQKLLHETYVLTGEGKMDAFKAYLNENVSWTEAAGFPYAGTY
FT                   IGPDEVVKNVHERLGTEWDNYSAKDEIYAFNNNTVIVYGKYSGTYKVTGKSFIADFCHL
FT                   YEFDENDKVKKFIQIVDSATVNEVLS"
     atgaataaat atcaaaaact attacatgaa acgtatgtat tgactggtga agggaaaatg        60
     gatgctttca aagcgtattt aaatgagaat gtatcttgga cagaagctgc tgggtttcca       120
     tatgcgggca cttatatagg tcctgatgaa gtagtgaaaa atgtacatga acgtcttgga       180
     actgaatggg ataactatag cgctaaagat gaaatttatg cttttaataa caatactgtt       240
     atcgtgtatg gaaaatatag tggaacatat aaagtaacag ggaaatcatt catagcagat       300
     ttttgtcatc tttatgagtt tgatgagaac gataaggtta agaagtttat tcaaattgtg       360
     gacagtgcaa ctgttaatga ggtattaagt tag                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page