(data stored in ACNUC9435 zone)

EMBL: CP000904.PE48

CP000904.PE48        Location/Qualifiers
FT   CDS_pept        74866..75393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5482"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="PFAM: protein of unknown function DUF1486; KEGG:
FT                   bcz:pE33L466_0282 possible pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5482"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46472"
FT                   /db_xref="GOA:A9VV40"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV40"
FT                   /protein_id="ABY46472.1"
FT                   /translation="MKLEKNLIIIIISVFILGIVSTLTFQSFIGNAKGNSIKSENVAPV
FT                   SKDDVAEKEKNKKMVVDFYNEVFNKHNIDIIPKYVSEDYKQHNPFVADGRKAFMDFFKE
FT                   DFVKNPNSSAEIKRVVAEGDTVALHVHSRANSQDKGVAIVDIFRIKDGKIVEHWDVIQE
FT                   ISNETANNNTMF"
     atgaaattag agaaaaattt aataataata attatttctg tgtttatttt aggaattgtg        60
     tcgactttga catttcaatc cttcattggt aatgccaaag gtaactcaat aaagagcgag       120
     aatgttgcac cagtatcgaa agatgatgtg gcagaaaaag aaaagaataa aaagatggta       180
     gttgatttct ataatgaagt ttttaacaaa cataatatcg atatcatccc taaatatgta       240
     agtgaagatt ataagcaaca taatcctttt gtggctgatg gacgaaaagc tttcatggat       300
     ttctttaagg aggattttgt taaaaaccct aactcctctg cagaaattaa acgtgtagta       360
     gctgaaggag atacagttgc tcttcatgta cattctcgtg ctaactctca agataaggga       420
     gttgctatag tggatatatt tcgtataaag gatggtaaga ttgtcgaaca ctgggatgta       480
     attcaagaga tttcaaatga aacagctaat aataatacta tgttttag                    528
//

If you have problems or comments...

PBIL Back to PBIL home page