(data stored in ACNUC9435 zone)

EMBL: CP000904.PE49

CP000904.PE49        Location/Qualifiers
FT   CDS_pept        complement(75695..76003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5483"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5483"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46473"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV41"
FT                   /protein_id="ABY46473.1"
FT                   /translation="MDNSKWISLSNVNDEEEIWAGARVRLYNVGMNREDKENDFYEYII
FT                   SYIYDNDNYLQLTNLTTGKAGYIICVIEKELPNNYALGKTLKQRMGLENTYFRFEYE"
     ttggataact cgaaatggat atctttaagt aatgttaatg atgaggagga aatttgggca        60
     ggggcaagag ttaggttgta caatgttggt atgaatagag aagacaaaga aaatgatttc       120
     tacgaataca ttatttctta tatctacgac aacgataact acttacaact aactaattta       180
     acaacaggaa aagcaggtta tattatttgt gtcattgaaa aagaattgcc gaataattat       240
     gctttgggta aaacattaaa gcaaagaatg ggcttagaaa atacctattt tagatttgaa       300
     tatgaataa                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page