(data stored in ACNUC9435 zone)

EMBL: CP000904.PE5

CP000904.PE5         Location/Qualifiers
FT   CDS_pept        8379..10856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5437"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46429"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUZ7"
FT                   /protein_id="ABY46429.1"
FT                   /translation="MFTNSGKIIKHATIPGAITFQSAGYVSISNELYEDSKVVFSFSKP
FT                   TEKVALIPKYLSDGNFLFASLDKENKLHIGGIVKDSEKIYGVVDVKDNILDSNTLTVSS
FT                   NGSHFTVTLNNKTVLKFESALFVNGQVRVYGEIGEVFNSCEIQEPQSTAWTSNANGGGV
FT                   EAKTIKIEDHDYVKLVGSATKKAMFSQSISLLAKDYTLSFNAQGNGEYLIKSGETILKQ
FT                   IAISKGELSYISQTFNLATPQTITLVFQTSEILIVGKHQLEDRVDPTSYIPNPSISSSA
FT                   TRKGSALKFPVKNLFDKKAGSIYLKLTTKNRMDRDQTIFCSDTREMSLSVHGTNLSYTV
FT                   GASSITLPKTLEGNTSYEFLCSWNDEGIELTVNGENAKALNTGLLLTTPQELIFANEET
FT                   PIQEEVVLEEWALFNNKLPANSNIKAQLPFAVMQSLFDGGISGQNVTWSEIPVAPIDHS
FT                   PILVQKENGDTLQKVSFFNHETAAYQTWNQEAFQYDGKSDFVEVAYNNLDEQFRDIAIR
FT                   TEDGEKIGEPYRIDGKRFYFSLHTNRKAVLKSKTLYATYQVNDTYTIDYNIKAVDGYRI
FT                   DFAKHDGGKRIVYQEGNRYGEPKKLATMIDMNPIQNQNHEGFLYITNTINKTDSFRITA
FT                   TPDRLHADGASFSTLIIEPLDYQGNFLSHSNLEIIASKGFVSRHISRDAVEAQKRSGQY
FT                   LYQYHAPYIQSKRAGEIVEDYIWITDKDNNIGVCYKMLLSPVSKPDKVQLTQVEKNLLT
FT                   AKTKIINYLLMYEGVERYEDEVLFSILDFNQDGRVTMDEILVLETNQKDNELTVILNKL
FT                   KEWEDTNHAVATS"
     atgttcacta attctggaaa aattattaaa catgctacaa taccaggcgc tattactttc        60
     caaagtgcgg gatatgtttc tatctcaaat gaactatatg aagatagcaa agtagtattc       120
     tcgttttcta agccgacgga aaaagtagcg ttaatcccta aatatttaag tgatggaaac       180
     ttcttatttg cttctttaga taaagaaaac aagttacata taggcggaat tgtaaaggat       240
     tctgagaaga tttatggagt cgtagatgta aaagataata tcttggattc taatactcta       300
     acagtctctt cgaatggatc tcattttaca gttaccttaa acaataaaac agtattaaaa       360
     tttgaatctg ctttattcgt taatggacaa gtccgcgtat atggggaaat aggagaagtc       420
     tttaattctt gtgaaataca agaaccacaa tctaccgcat ggacaagtaa tgcaaacggt       480
     gggggagtag aggccaaaac aattaagata gaagaccatg actatgtaaa actagtaggc       540
     tctgcaacta agaaagcaat gttctctcaa tctatctctc tacttgcaaa agattacaca       600
     ctttcattca acgctcaagg gaatggtgaa tacctaatta agtctggaga gacaatttta       660
     aaacagattg ctatttcaaa aggagagttg tcttacatct ctcaaacttt taatttagca       720
     accccacaaa ctattacttt agtattccag acaagtgaaa tacttatcgt aggaaaacat       780
     caattagagg accgcgtaga ccctacgtcg tacataccga atcctagtat tagtagttcg       840
     gcaacccgca agggatcggc gctgaagttt ccagttaaaa acttgttcga taaaaaagca       900
     ggaagtatct atttgaaact aactacaaaa aatcgtatgg atagagacca aactattttc       960
     tgttcagata caagagagat gtctctttcg gtacatggaa ctaacttatc gtataccgtt      1020
     ggtgctagtt caattaccct ccctaaaaca cttgaaggaa atacgtcata tgaattcctt      1080
     tgtagttgga atgatgaagg tattgagcta acagtaaatg gggagaatgc aaaagcttta      1140
     aatactggtc ttctacttac aactccccag gaattaattt tcgcaaatga agaaacacct      1200
     attcaggaag aagttgtctt agaagaatgg gcgttattca ataacaaatt accagctaac      1260
     tcaaacataa aagcacagct accttttgca gttatgcagt ctttatttga tggtggaatc      1320
     agtggtcaga atgttacatg gtcagaaatc cctgtagctc caattgatca ttcacctatt      1380
     ctagttcaaa aagagaatgg agatacgtta caaaaagtat cattctttaa tcatgaaaca      1440
     gcagcgtatc aaacatggaa tcaagaagca ttccagtatg acggtaaaag cgatttcgtt      1500
     gaggttgcgt acaataatct tgatgagcaa tttagagata ttgctattcg tacagaggat      1560
     ggagaaaaaa taggagaacc ttatcgaata gatggtaaga gattttattt ctctcttcac      1620
     acaaacagga aagcagtgtt aaaaagcaaa accctctatg caacgtatca agtgaacgat      1680
     acatacacga ttgattacaa tatcaaagct gttgatggtt accgaatcga tttcgctaaa      1740
     catgatggcg ggaaaagaat tgtgtatcaa gaaggaaacc gttatggtga gccaaagaaa      1800
     ctagcaacaa tgattgatat gaatccaatt caaaatcaaa atcatgaagg gttcttatat      1860
     attacgaaca caataaataa gaccgatagc tttagaatta cagctactcc agatcgatta      1920
     catgcagatg gagctagttt ctctacactg attattgaac cacttgatta tcaagggaac      1980
     ttcttatctc actccaattt agagattatt gcttccaaag gttttgtttc tcgacacatc      2040
     tcaagagatg cagttgaagc acaaaaacga tcagggcaat acctgtacca ataccatgct      2100
     ccatatattc aatcgaagcg tgcgggtgaa attgtagaag attatatttg gattacagac      2160
     aaggataata atattggtgt ttgctacaag atgttattaa gtcctgtgtc aaagccagat      2220
     aaagttcaat taacgcaggt agaaaagaat ctattaactg ctaaaacgaa aatcattaac      2280
     tacctcctta tgtatgaggg agtagagaga tatgaagatg aagtactttt ctctatctta      2340
     gattttaacc aagacggtcg tgtaacaatg gacgagatct tagtgttaga aacaaatcag      2400
     aaagataatg aattgactgt tatcttaaac aagttaaaag aatgggagga tacaaaccat      2460
     gcagttgcaa cctcataa                                                    2478
//

If you have problems or comments...

PBIL Back to PBIL home page