(data stored in ACNUC9435 zone)

EMBL: CP000904.PE50

CP000904.PE50        Location/Qualifiers
FT   CDS_pept        complement(76032..77060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5484"
FT                   /product="Insertion element protein"
FT                   /note="PFAM: Insertion element protein; KEGG: gtn:GTNG_0770
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5484"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46474"
FT                   /db_xref="InterPro:IPR024442"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV42"
FT                   /protein_id="ABY46474.1"
FT                   /translation="MSKAFSNLLKHIGNLSHTEKEQVFQWVKRYVEPSSSVGGRLINEM
FT                   RETRFKEGFECPHCASEHVVRFGKHNNRQRYRCKCCSKTFTDTTNTVLYRTRKGNEWIT
FT                   FVDCMFKGYSLRKSAEIVGVTWVTLFYWRHKLLSALKQLDFEKFEGIVEVDETYFLYSQ
FT                   KGQRGISERKPRRRGGKSKHRGISHEQVCVLVARDRTKATVSKIACMGRVVKTKVDSMI
FT                   GSKLTSDNVLVTDAWRAYKTYAKEKGIEHYRIKSNDGKHVIKGLYHIQNVNGLHSRMKQ
FT                   WIDRFKGVATKYLDNYLAWFLFIDRKSNESTKHNIKEFLLTSFVFEMTDTYDSLRLSKF
FT                   SV"
     ttgagcaaag cgttcagtaa tctattgaaa catattggca atttgtcaca cacagagaaa        60
     gagcaagtgt ttcaatgggt aaaacgctat gttgaacctt cttcctctgt cggtggtcgt       120
     ctaatcaatg aaatgagaga aactcgtttc aaggaagggt ttgaatgtcc tcattgtgca       180
     tccgaacacg ttgttcgttt cggtaaacac aataatcgcc aacgctatcg ttgtaaatgt       240
     tgtagtaaga cattcactga tacaacgaat actgttcttt accgtactcg aaaaggaaac       300
     gaatggatta catttgttga ttgtatgttt aaaggatatt ccttgcgaaa gtccgctgaa       360
     atcgtggggg ttacatgggt tacacttttt tattggagac ataaattgtt aagtgcgtta       420
     aaacaattgg attttgagaa atttgaaggt atcgttgaag ttgacgagac ctatttccta       480
     tactctcaaa agggtcaacg tggtatttca gaacgcaaac ctcgtaggcg tggtggaaaa       540
     tctaaacaca gaggtatcag ccacgaacaa gtttgtgttc ttgttgccag agaccgtacc       600
     aaagcgactg tctccaagat tgcttgtatg gggcgtgttg tgaaaacaaa agttgatagt       660
     atgattggtt ctaaattaac atcggataat gtacttgtta cagatgcttg gagagcctac       720
     aaaacgtatg caaaagaaaa aggaatagag cattacagaa ttaaatcaaa cgatggtaag       780
     cacgttatta aaggcttgta ccatatccag aatgtaaatg gtctccattc tcgtatgaaa       840
     caatggatag accgttttaa aggtgtggct acaaaatatt tagacaacta ccttgcgtgg       900
     ttcttgttta tagatagaaa aagtaacgaa agcacaaaac acaacattaa agagttctta       960
     ctcacatcat ttgtatttga aatgactgat acttatgata gtttgcgtct gtcaaaattc      1020
     agtgtataa                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page