(data stored in ACNUC9435 zone)

EMBL: CP000904.PE51

CP000904.PE51        Location/Qualifiers
FT   CDS_pept        78259..78669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0278 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5485"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46475"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV43"
FT                   /protein_id="ABY46475.1"
FT                   /translation="MNMKTFEMREKRLAELLGAKVLWEFISAVTEEIEKQELESTPGLL
FT                   EDLFIHVKETIQIQNMNQGITKAPVKTEADGIDKDTLFMEAYVELINHKFVISELVVEL
FT                   SSVLKELNCFVQSSLPLLQNKLDSQESQSASL"
     atgaacatga aaacatttga aatgcgtgaa aaacgattag cagaactact aggtgcaaaa        60
     gtattatggg agtttataag tgctgtcaca gaggaaattg aaaagcagga attagaatct       120
     acacctggtt tattagaaga tctattcata catgtgaaag agacaattca aattcagaat       180
     atgaatcaag gcataacaaa agcccctgta aaaacagagg ctgatggtat agataaagat       240
     acattattta tggaagcata tgtagaatta atcaatcata aatttgttat ttctgaatta       300
     gttgtagagc tttcatctgt tctaaaagaa ttaaattgtt ttgttcaatc atctttgcca       360
     ctgcttcaaa ataagcttga ttctcaagaa tctcaatctg cttctcttta g                411
//

If you have problems or comments...

PBIL Back to PBIL home page