(data stored in ACNUC9435 zone)

EMBL: CP000904.PE52

CP000904.PE52        Location/Qualifiers
FT   CDS_pept        complement(79494..80138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5486"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46476"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV44"
FT                   /protein_id="ABY46476.1"
FT                   /translation="MNIELLDTHHVKDAAHLLAHSFVNNEPLVSSLQIPFASFHKMCEE
FT                   MMKQAVSQAMSFVAIENFQIVGVLLTKKVTQPLIDTDKATELCPQMEPIFQLLDTLETE
FT                   SIEFSHLDKEKLVYLDMGACHPDWMGSGIVTSLISHAIQEISKKDFDFIAACTNKISQK
FT                   ILKKLFTTLEMNEIVYSNFPYKEAYPFANTTTSLAAQLLYIPQSQFVIKAI"
     atgaatatag agctactaga tacacatcac gtgaaagatg cagcacattt acttgcacat        60
     tcttttgtga ataatgaacc tcttgtaagc agtttacaaa ttccttttgc ttcttttcac       120
     aaaatgtgcg aagaaatgat gaaacaagct gtatctcaag ccatgtcatt tgtagcaata       180
     gaaaattttc aaattgttgg agttctttta acaaaaaaag taacccagcc actaatagat       240
     acagataaag cgactgaact atgcccacaa atggaaccta tttttcaact tttagataca       300
     ttagagacag aatctattga gttttctcat ttagataaag aaaaattggt ctatctagat       360
     atgggcgctt gtcatccaga ttggatggga agtgggatag tcaccagcct tatttcacat       420
     gccattcaag aaataagtaa aaaagatttt gattttattg ctgcttgtac aaataaaatc       480
     tctcaaaaaa tccttaaaaa actgtttacg accttggaaa tgaatgaaat agtgtatagt       540
     aattttcctt ataaggaagc atacccattt gctaacacaa caacttcctt agcagctcaa       600
     ttactatata tacctcaatc ccaattcgtc atcaaggcca tataa                       645
//

If you have problems or comments...

PBIL Back to PBIL home page