(data stored in ACNUC9435 zone)

EMBL: CP000904.PE54

CP000904.PE54        Location/Qualifiers
FT   CDS_pept        83671..90990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5489"
FT                   /product="amino acid adenylation domain"
FT                   /note="TIGRFAM: amino acid adenylation domain; PFAM:
FT                   AMP-dependent synthetase and ligase; condensation domain
FT                   protein; NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   phosphopantetheine-binding; Male sterility domain; KEGG:
FT                   rso:RS05859 probable peptide synthetase protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5489"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46478"
FT                   /db_xref="GOA:A9VV46"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV46"
FT                   /protein_id="ABY46478.1"
FT                   /translation="MKEIQKQYEIVEELDATVGQEALWIAHQMELENGMNNEATIIKLK
FT                   GNLQIDTFKKALTLIVQSHPALRTLFIKRDEKIKQFIQKSIDFDIPIKDLTAFKNTEQK
FT                   FILKKFLDSIVNEKFNLEEGPLFKFHIIKLCEDEFILHMIFHHIIYDGCSLGIFIQQLS
FT                   HTYCELLQENTGLVLESPYKSLIEFEEGFIDSAIYREGSSYWKDYLQGELPPTEFPATI
FT                   NKMNEPIYTNENISKNIDADLFYQIQCFAKRNNISVYRVMLSTYCALLHQMTNAEEIIV
FT                   GIPINTRPHTEEGNAFGYFVNTLPIRITIEKGDTFKGILNKVNKSVHLAIKYKHNPYSH
FT                   IVKDSNLNNNTHHNMIYSTAFNTVRIPQLKILDIESTVLTDCKRVNPFNMTWRIMRYEG
FT                   ETENKIEVDYNSALYKAESISDLVERYIYLLQELMKNVNELIHSLDLLLKKDHRLYKDI
FT                   NSNTLAYPNSKTLDQLIDLQALKSPNQIAISMGDKSITYYDLQQRSNQIANYLRENDIK
FT                   KGQRVSITMVREIDTIVWILGILKSGGVYVPIDPKFPEKRIEYILKDSESQMIITKKEF
FT                   RGLIESFAIHTIYLEDFHYANSIENIVPTHTIEDTAYIIYTSGSTGLPKGVGVPHKGVI
FT                   NLSYSLMNQFNLDKNDVFLQFATMIFDASIMEIFPILLCGGRMHLISEMEKRSAEEFIN
FT                   VINKNGITYVLLPTAFFKLIADMPKEMLLTLNSLKCVFVGGETIPAESVRKWQSKLGLK
FT                   IPVLNAYGPTEATVCTTIYEVNHEIKEENSNIPIGKPIANSKVFVVSPFNTICPSGVVG
FT                   ELFIGGDGVAKGYINQKEKTEEAFISFGESYNRDKKMYRTGDLVRLLPSGKIDRKKLEL
FT                   QIPSLLENMKNQYVPPISETEKRLVKTWSEILNLGKYRISRDDDFFKLGGHSLIAVQVL
FT                   NQIQKEFHLKIEIRDIFEHTTIASLSAYIDKLMEVNTDREEHDMQVLKVADKECYKLSS
FT                   AQKRIWFLNKYNAINRVYDTQLHINIEPSLKKNILQDAIRFLVERHEMLRTVFIEKNGE
FT                   PRQVILKSISIDLIHDDIEHITKKEQQEYIRRTINQTDHTPFDLENGPLFRIRIFNLDK
FT                   KRSYIYINLHHIITDEWSVRNLLDELMKVYNAFANRRNPYLPTISNRYVDYVEWEHKQL
FT                   KLGRWDTEKSYWMTELAAPLPILNLPLDFSRDRQSTNKGKVFEMKLDNKMKESLKQVCE
FT                   QENVSMYMLFLAVYIQLLHYLTDQKDIIVGTPVAGRNYQEFEQIQGFFVNTLAIRTQLN
FT                   DVKNLKQLVQVVKEKCLNSFQNQSYPFDKVIEQINPDRSFGNNPIFSTMFSYQKDILQQ
FT                   HDEHKLQLLTNKQDVSKFDISLSVEEGLDYVGISFEYDINLFKEESINRFTQNLLNILD
FT                   AFIHQRTVAYETLSFLSQEEVSLYRKVNHTERPYPYFQNIQEQFYKQVDRQSNRIAIAT
FT                   ETESLTYRQLNMDSNQVAQHLLEKGIKTGDKVAIFLDRSINSIVSMIGILKAGAAYIPI
FT                   DVKYPEDRINYIVSDSEACRIITNNKYKSHLNSSNYNVSIIEDIYRTTINDDVKILNKP
FT                   DDLAYVIYTSGSTGKPKGTLLTHKGVLNLAEWRNEVFHISPNDKVTQFYSHSFDSSVSE
FT                   IFSTLLNGAELYLLSDEQRYSTVAYAQAIQEIQATLSDVPTVFFNELSTSLTKLDSEKI
FT                   RSLRFMIMGGEAASTNAIRSWQNTFKNQVQLVNEYGPTEATVSAMYYFIPILEDENSLL
FT                   GNIPIGIPISNTKVHILNSYMQHCPVGGMGELYIESLGLAQGYWKQEEKTNQAFISSPF
FT                   SEDNSKRVYRTGDLAKWLPNGNIEFMGRKDKQVKIRGHRIELGEIEDALLQFEGISQAV
FT                   ITQTKDGMLLQAYYKTVDGIEIEKNKLAIHLSNVLPEYMIPKYYSHVLEIPITANGKID
FT                   FEKLPEIDFDNEQKDDCILKPQTKVQKNIAKVWSEVLNIKSIGLKDDFFNLGGHSLKVM
FT                   PALVKLKPLYPNLKIQDFFKYRTIENLAYHIEEMEDMSLKNEKNINVACIENETKTNPV
FT                   YKRTKLEECELDMVNYPKAVFLTGATGYLGAHILEQLLQLPSTTIYCLVRKNENQVIDE
FT                   KLKERMRFYFGKEILQKLEERVELIEGDLSLINLGLDPKKVDHLKSNVESIIHCGGEVR
FT                   HYGEREHFQKVNVQSTKYLLELAKNTNARFHYISTLSVVGQAESDPKEFKFFESNFDRG
FT                   QNLDNVYLESKFQGEKMVREAMEKGVRATIYRVGNLVGNSKTGKFQFNINENAFYRLLK
FT                   GICLSNIAPEINTYVDLTPVDYGSLAITELSYKANTVNKTMHICNPTQLKWDQFINSLQ
FT                   VFGYDLMLMRQEKYIEKFFNTNLTTDEQKALELIMPLLESVEELSVAIPSCLYTQGYLK
FT                   NVHCLEPNQEYINLLLNYAMSIEFLPTIKEPILL"
     atgaaggaaa tacaaaagca atatgaaatt gtagaagaat tggatgcaac agtagggcaa        60
     gaagcattat ggatagctca tcaaatggaa ttagaaaatg gaatgaacaa tgaagctacc       120
     ataataaagc taaaaggaaa tcttcaaata gatactttta agaaagcgct tactttaata       180
     gtgcaatctc atccggcgct gcgtacacta tttattaaaa gggacgaaaa aattaaacaa       240
     ttcattcaaa agagtataga ttttgatata ccaattaagg atttaactgc ttttaaaaac       300
     acagaacaaa aatttatttt aaaaaaattc ttagactcta tagtgaatga gaaatttaat       360
     ttagaagaag ggcctttgtt taaattccac atcattaaat tgtgtgaaga tgaatttatt       420
     ttacatatga tttttcatca cattatttat gatggatgta gtttaggaat ttttatccaa       480
     caattgtctc atacgtattg tgaattactt caagaaaata cgggtttagt attagaatct       540
     ccttataaga gccttataga atttgaggaa ggttttattg acagtgcaat atatagagaa       600
     ggatcatcct attggaaaga ttatttacaa ggtgaattac ctcctacaga gtttcctgct       660
     actattaata aaatgaatga accgatatat acgaatgaaa atataagtaa gaatattgat       720
     gccgatctat tttatcaaat acaatgtttt gctaaaagaa ataacataag tgtctatcgg       780
     gttatgttaa gtacttattg tgccttgctt catcaaatga caaacgctga agaaattatt       840
     gtaggtattc caattaatac tagaccacac acggaagaag ggaatgcttt tggttatttt       900
     gttaatacat tacctatacg tataacaata gaaaaggggg atacatttaa gggaatactt       960
     aacaaggtga ataaatctgt tcatttggct attaagtata aacataatcc atattcacat      1020
     atagtaaaag attcaaatct aaataataat acacatcata atatgatata ttcaacagca      1080
     tttaatacgg taaggatacc tcaattgaaa attctagata ttgagtccac agttttaaca      1140
     gattgtaaaa gagtaaatcc ttttaacatg acctggagaa taatgagata tgaaggggaa      1200
     acagagaata aaattgaggt tgactataat tcagcgttat ataaagcaga gagtattagt      1260
     gatttagttg aaagatatat atatttgtta caagaactaa tgaagaatgt aaatgagctt      1320
     atccattcat tggatttact tttaaaaaag gatcatcgtt tatacaaaga tataaactca      1380
     aatactcttg catatcctaa ttcaaaaaca ctagatcaat taatcgatct acaagcatta      1440
     aaatcgccaa atcaaatagc gatttcaatg ggggataaat cgattaccta ttatgacttg      1500
     cagcaaaggt caaatcaaat tgcgaattat ttacgtgaaa atgatataaa aaagggacag      1560
     cgtgtaagta ttactatggt gagagagatt gatacaattg tgtggattct aggcatacta      1620
     aaatcaggtg gagtttatgt accaatcgat ccaaagtttc ctgaaaaaag aatagaatat      1680
     atattaaaag atagtgaaag tcaaatgatt attacaaaga aagaattcag gggattaatt      1740
     gaaagttttg cgattcatac aatttatcta gaggattttc attacgctaa ttctatagaa      1800
     aatattgtac ctacacatac catagaagat acagcgtata ttatctacac gtcaggttcg      1860
     acaggtttac caaaaggagt aggtgtacca cataaaggag taattaattt atcatattca      1920
     ttaatgaatc aatttaattt agacaaaaat gatgtatttt tacaatttgc aacgatgatt      1980
     tttgatgcct ccattatgga aatatttccg attttgttat gcggagggag aatgcattta      2040
     atttctgaaa tggaaaaacg ttctgcagaa gaatttataa atgtaattaa caagaatggt      2100
     attacatatg ttcttttacc aactgcattt tttaaattaa tagctgatat gccaaaagaa      2160
     atgttactta cattaaattc tttaaaatgt gtatttgtgg gaggggaaac catacctgct      2220
     gaatcagttc gtaaatggca aagtaaatta ggattaaaga ttccagttct taacgcatat      2280
     ggtcctactg aagctactgt atgtacaacc atttatgaag taaatcatga gataaaagaa      2340
     gaaaattcta atatcccaat aggtaaacca attgctaata gtaaagtttt cgtggtcagt      2400
     ccgttcaaca cgatatgtcc gtcaggagta gtaggtgagt tattcattgg tggtgatggg      2460
     gttgccaaag gatatataaa tcaaaaggaa aaaacagaag aggcatttat ttctttcggg      2520
     gaatcctata atcgcgataa aaaaatgtat cgtactgggg atttagtacg tcttttacca      2580
     agtggtaaga ttgatagaaa aaaattagaa ttacaaatcc catctttact tgaaaatatg      2640
     aagaatcaat atgtaccacc aataagtgaa acagaaaaaa ggttggtaaa aacatggtca      2700
     gagattttaa atttagggaa atatagaatc agcagagatg atgacttttt taaacttggg      2760
     ggacattcat taattgctgt gcaagtgtta aatcaaattc aaaaagagtt tcatttgaaa      2820
     atagaaatta gagatatttt tgagcataca acaattgcta gtctatctgc ttacattgat      2880
     aaattaatgg aagtaaatac ggatagagaa gaacatgata tgcaagtatt aaaggttgca      2940
     gataaggaat gttataagtt atccagtgct caaaaaagaa tctggttttt aaataagtat      3000
     aacgctatta atagagtata tgatacacaa ctacacataa atattgagcc aagtttaaaa      3060
     aagaatattt tacaagacgc cataagattt ttagttgaac gacacgagat gctacgaaca      3120
     gtgtttattg aaaaaaacgg ggagcctaga caggtcatat taaaatcaat atctattgac      3180
     cttattcacg atgatattga acacataact aaaaaggaac aacaagaata tatacgtaga      3240
     acaataaatc aaacggatca tacaccattt gatttggaaa atggaccact tttccggatt      3300
     agaattttta atcttgataa gaaaagatcc tatatatata tcaatttaca ccatattatt      3360
     accgatgagt ggagtgtaag gaatttatta gatgaattaa tgaaggtata taatgccttt      3420
     gctaatcgaa gaaatcctta tttaccaact atttccaatc gatatgtgga ttatgttgag      3480
     tgggaacaca agcagctaaa attaggccgg tgggatacag aaaaatctta ttggatgacc      3540
     gagcttgcgg cgcctcttcc catactaaat cttccgttag attttagtag ggatcgtcaa      3600
     agtacaaata aaggtaaagt ctttgaaatg aagttagata ataaaatgaa agagtctttg      3660
     aaacaagtat gtgaacaaga gaatgtgtct atgtatatgc tatttttggc agtatatata      3720
     caattgttac actatctaac ggatcaaaaa gatattattg taggtacacc ggttgccgga      3780
     aggaattatc aggaatttga acaaatacaa ggattttttg taaatacttt agctattaga      3840
     acacaattaa atgatgtgaa aaatttaaaa caactagtac aagtcgttaa agaaaaatgt      3900
     ttgaattctt tccaaaacca atcgtaccca tttgataaag taattgagca aataaatcct      3960
     gatagaagtt ttggaaataa ccctatcttt tctacaatgt ttagttatca gaaagatatt      4020
     ttgcaacagc atgatgagca caagcttcaa ttgttaacta ataaacaaga tgttagtaag      4080
     tttgacattt ctctatctgt tgaagaaggc ttggattatg taggtatttc atttgagtat      4140
     gatattaatt tattcaagga agaatcaatt aataggttta ctcaaaattt acttaatata      4200
     ctggacgcat ttattcatca acgaacagta gcatatgaaa ctctttcatt cctatcacag      4260
     gaagaagtat ctctatatag aaaggtaaat catacagaaa gaccatatcc ttattttcaa      4320
     aatatacagg agcaattcta taagcaagta gatagacaat caaatcggat tgctatagct      4380
     acagaaacag agtctttaac atatagacaa ttaaatatgg attctaatca agtagcgcaa      4440
     catttactcg aaaagggtat aaaaacaggt gacaaagtag ccatattttt agatagaagt      4500
     attaatagca ttgtctctat gattggaata ttaaaagctg gtgctgccta tataccaatc      4560
     gatgtaaaat accccgagga tagaattaat tatatagtaa gtgacagcga ggcatgtaga      4620
     attataacga ataacaaata caaaagtcat ttgaattcaa gtaattataa cgtttcaata      4680
     atagaggata tatatcgtac gacaataaat gatgatgtta aaattttaaa taaaccagat      4740
     gacttggcat atgtaattta tacatcagga tcaacaggca aaccaaaagg tacattatta      4800
     actcataaag gagtattaaa tttagctgaa tggagaaatg aagtatttca tatttcccca      4860
     aatgataaag taacacagtt ttattcccat agttttgatt cttctgtatc ggaaattttt      4920
     tctaccttgt taaatggggc ggaactatat ttattaagtg atgaacagcg ctattcaact      4980
     gtagcatatg ctcaggctat ccaagaaata caagcaactc tttctgacgt accaacagta      5040
     ttttttaatg aattatcgac ttcattaact aaactggata gtgagaagat acgttcttta      5100
     agatttatga taatgggagg ggaagctgca tcaacaaatg ctattaggag ttggcaaaat      5160
     acttttaaaa accaagtaca actggtaaat gagtatggcc ctactgaagc aactgtttca      5220
     gcaatgtatt acttcatacc aatattagaa gatgagaata gtcttttagg aaatataccg      5280
     attggtattc caatttctaa tacaaaggtt catatattga actcgtatat gcaacattgt      5340
     ccggtagggg gcatgggtga attatatatt gagagtttag gattggccca agggtattgg      5400
     aagcaggagg agaaaacaaa tcaggcattt atttcaagtc cattttcaga agataatagt      5460
     aaaagggtat accgaacagg tgatttagca aagtggttac caaatggaaa tatagaattt      5520
     atgggaagaa aagataagca ggttaaaatt agagggcata gaattgaatt aggggaaata      5580
     gaagatgcac tattacaatt tgaggggata agtcaggctg tgataacaca aacgaaagat      5640
     ggaatgctat tgcaagctta ctataaaaca gtggacggta tagaaataga gaaaaataag      5700
     ttagcaatac atttatcaaa tgtattgcca gaatatatga ttcctaaata ttactctcat      5760
     gtgttagaaa taccaataac ggctaatggg aaaattgatt tcgaaaaact tccagaaata      5820
     gattttgata atgagcaaaa ggatgattgt atacttaagc ctcaaactaa agtgcaaaaa      5880
     aacattgcaa aagtatggtc tgaagtttta aacataaagt ctattggttt aaaagatgat      5940
     ttctttaatt tgggtggaca ttctttaaaa gttatgccgg cattagttaa attaaaaccg      6000
     ttatacccta acttgaaaat tcaagatttc tttaagtata gaacaataga aaatttagcc      6060
     tatcatattg aagagatgga agatatgtcg ttaaagaatg agaaaaatat taatgtagca      6120
     tgtattgaaa atgaaacgaa aacgaatccg gtttataaaa gaactaaatt agaagaatgt      6180
     gagttagata tggtgaatta tccaaaagca gttttcctta caggagcaac aggatattta      6240
     ggcgcacata ttttagaaca attattacag ttgccatcta cgactattta ctgtttagta      6300
     agaaaaaatg agaatcaagt aattgatgaa aagttaaaag aaagaatgag attttatttt      6360
     ggtaaagaaa ttcttcaaaa gttggaggag agagtagaat taattgaagg agatttatct      6420
     ttgataaatc taggtcttga tccaaagaaa gtggatcatt taaagagtaa cgtagagtca      6480
     ataatacatt gtggtggaga agttagacac tatggagaac gtgagcattt tcaaaaggta      6540
     aatgttcagt ctacaaaata cttattggaa ttagctaaga atacaaatgc acgctttcat      6600
     tatatatcga ctttaagtgt ggtaggacag gctgaaagcg atccaaaaga atttaaattc      6660
     tttgagtcta attttgatag agggcaaaat ttagataatg tatacttaga aagtaagttt      6720
     caaggcgaga aaatggtcag agaggcaatg gaaaaaggag ttcgtgctac tatataccgt      6780
     gtgggaaatt tagtgggtaa ctctaaaacg ggtaaatttc aattcaatat taatgaaaac      6840
     gctttttata gattattgaa aggtatatgc ttatctaaca tagcacctga aatcaatacg      6900
     tatgtagatt taacacctgt ggactatgga agtttagcca ttactgaact atcttataag      6960
     gccaacacag taaataaaac catgcatatt tgtaatccaa ctcagcttaa atgggaccaa      7020
     tttattaata gtttacaagt ttttggatac gatttaatgt taatgaggca agaaaagtat      7080
     atagagaagt tttttaatac taatctaact actgatgaac agaaagcttt agagctcata      7140
     atgcctttat tagaatctgt agaagagcta tcagtagcta taccatcttg tttgtatacg      7200
     caaggatatt tgaagaatgt acattgctta gaaccaaatc aagagtatat caatttgtta      7260
     ttaaattatg ccatgagtat agagttttta ccaaccatta aagaaccaat attgttatag      7320
//

If you have problems or comments...

PBIL Back to PBIL home page