(data stored in ACNUC9435 zone)

EMBL: CP000904.PE56

CP000904.PE56        Location/Qualifiers
FT   CDS_pept        92532..93257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5491"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ckl:CKL_0037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5491"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46480"
FT                   /db_xref="GOA:A9VV48"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV48"
FT                   /protein_id="ABY46480.1"
FT                   /translation="MQFIFKSVNSEMRKIGGRKLLLISLFFSLLSSFLCISYFIFNKNH
FT                   PDMFQSTNLIAITVNFNTLTLSIFSACMWYFIISSENKYGTWAIIYTQPISKLKLLVTK
FT                   NLMFILFYLVFNILNFLVMGIYTFINGYEISILYFLKMLILCTILSLAIPYSQLLFHLI
FT                   IKKGILAASLSVVWLFFFITYGLFPLIFTKTFPIFYSLNIVSDVAFKETIILLYLAISS
FT                   IYILGIMLLSVSFKYYTYE"
     atgcaattta tctttaaaag tgtaaatagt gagatgagaa aaattggtgg gagaaaatta        60
     ttattaatct ctttgttttt ttcgttatta tcaagctttt tgtgtataag ttattttatt       120
     tttaataaga atcatcccga catgtttcaa tctacaaatc ttatagcaat tacagtaaat       180
     tttaatacac taacgttaag tattttctct gcttgtatgt ggtattttat catttcttcg       240
     gaaaataaat atggtacttg ggccattatt tatacacagc ccatttcgaa acttaaatta       300
     ttggtaacta aaaatttaat gtttatactg ttctatttgg tctttaatat tttgaatttt       360
     ttggttatgg gtatctatac ttttataaat ggatatgaaa tatcaatact ttatttttta       420
     aaaatgttga tactttgtac gattttatct ctagcaatac catattctca attgcttttt       480
     catttaatta taaaaaaggg aattcttgcg gcatccttgt cagttgtttg gctttttttc       540
     tttataacat atggattatt ccctttaata tttacaaaga catttccaat cttttattca       600
     ttgaatatag taagtgacgt agcgtttaaa gaaacaatta ttttattata tcttgcaatt       660
     tcttcaatat atattttagg aattatgtta ttgtctgtga gttttaaata ttatacatat       720
     gaataa                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page