(data stored in ACNUC9435 zone)

EMBL: CP000904.PE57

CP000904.PE57        Location/Qualifiers
FT   CDS_pept        93273..93986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ckl:CKL_3049 predicted ABC transporter,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5492"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46481"
FT                   /db_xref="GOA:A9VV49"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV49"
FT                   /protein_id="ABY46481.1"
FT                   /translation="MGILGEYKKSLHNGLYILLLVFLLIPISFQVLLTVSSQLKDGVFM
FT                   HIAILSLFCRLFLPIAIGLLVSFSFVNEFRRKGYMSAIYHGITLKTILSNKFLFCLIIT
FT                   FGYLLCALIITSIPIVLTVDNLGTVYQSLSFSILFMVISSLIIVNLHFLINIIFYKIPL
FT                   LSLLVGVIGGLGSFFISHTNYWILFPWSYPIMSLYIDSIETKQLYIILFVYLLSLLSCI
FT                   LMLSTLYNKKSMRWN"
     gtgggtattt taggtgaata taaaaaaagt cttcataatg gattgtatat cctgttacta        60
     gtatttctgt tgattccaat tagttttcaa gttttactaa ctgtatcgtc tcaattaaaa       120
     gatggcgttt tcatgcatat agcgattctg agcctttttt gtaggttatt tttacctatt       180
     gcgataggtc tattagtgtc attttctttt gtaaacgaat tcagaagaaa aggatatatg       240
     tctgctattt atcacgggat cactttaaaa actatattaa gtaataagtt tttattttgc       300
     ttaataatta cttttggtta tttactatgt gctttaatca taacgagtat acctatagta       360
     ttaacggttg ataatctcgg gactgtttat caaagtttaa gtttttctat actttttatg       420
     gtaattagct ctttaattat tgtgaatcta cattttttaa taaatataat attttataaa       480
     atcccgttac tttcattatt agtaggggtt ataggtggac ttggtagctt ttttatctct       540
     catacaaact attggatact attcccttgg tcatatccaa ttatgagtct ttatattgat       600
     agcattgaaa caaaacaatt gtatattatt ctctttgtat atctattatc attactaagt       660
     tgtatattga tgttgtctac tttatataat aaaaaatcaa tgagatggaa ttaa             714
//

If you have problems or comments...

PBIL Back to PBIL home page