(data stored in ACNUC9435 zone)

EMBL: CP000904.PE6

CP000904.PE6         Location/Qualifiers
FT   CDS_pept        10837..15351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5438"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46430"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUZ8"
FT                   /protein_id="ABY46430.1"
FT                   /translation="MQLQPHKDLVRSGQRNRGYAIRIGNKVPKNSANLAYVQSKSVSPE
FT                   ENILLEDVSSQIKENGLSNFIEKDYMVYPNNKFLLETESGQAIFPTDAVFVTDEFTIRK
FT                   NRQDTPKPVFYQMELKGRFDARTSQVIPYLGGFSSETEQDAIALEDVVLDKRNDLIYVG
FT                   NSIRIEANGGPIQEEDEYKVQLIREDNFIYRIVVVTNFRNDKDVTYKVVYPNYRNDIKQ
FT                   SELKEEVLNAYPFFEQVTMDQFEDIVSQMGSDPDKYKHLKVYAIEEKGNDFSFYATSDV
FT                   MIANYQTRTPQLFKHRVEAKLKTKLSETNPGKMNIGFSFVQSVANVENLSSIGKAINEH
FT                   LSLPKYVELQNPHPTEVDLLKKDIGYWAVNLDMPDHHYEDYDLLVITGYGKADLSMFKD
FT                   KFEHYLKNGGTIWIDNAGSGINVLDFKTSKGNTFVSDIGFSSSSNEFGVKEITKDSPYT
FT                   SRLLPIKNIEALGYTDIAPTILFGQDEESKQWDAVVKHFNGGPSIIKKTLFDKGTVLVS
FT                   NCGIFRSFYHNQKESVNLVLNSILYHSEEQWVFTPWRNDFVYHRDNLFAQEYKVNNTDV
FT                   YINDRSDYNANQIVAKKILYKNCKEYVKIYCKPWFYNAIGTYEHAVNGDKSIPVNNSGF
FT                   ESGQVDSSGKPIVSWTSDTVNAIPSWNTKKLAGQTVTFTHDSDKSLFGVRQVSLNSSNG
FT                   TTGAHAYWESEDIYLSIDDYKVTVWTTIDQVRGVTTDGIKIGVYNLQGEQISSSISITG
FT                   KKDWVKLETNFHIDKPQNIKIRLGFVDGNGLGKASFDNVTLDTIGAVRGVAQNEGEKTL
FT                   YAFSIKPNATTIDIEAEGFGNANITRATPEVSFTYTIMPFILQWISYGIDSGTGLEYGR
FT                   YERMYGPPVSYSKAIRKTDGLKNLGYLHTLLPPVPSGKQWYDKNKIFYKIALGSENLEE
FT                   NNFVNLKLFDRKTGMEWFYSGDLVIGHKDIFWATDKPSFVLHAETGFETIRASKRNFGL
FT                   KLIDDRRIYSELPQTKDAKENWYLRIHNGQFIKDGLGYKEWSELHASNNPAVMNQYKER
FT                   VMKKEKYQIDEYASQIFNPSIGIMTVENEMEYLTPSTVKVPHNNLFVSQGFVEKEQLLV
FT                   EGLANSVGTLFRAKQKDWLRNDKVHIFIDVSNNGNIVEIFEEYPFEINLDEGTVFFPGR
FT                   IITGKVYATYEHRNFRLYKRIYKNTKMSNDLLENKRIDSVTKEVIMYGSKENWLIQPIP
FT                   VLKTTKGKATSANTIPATNYRIDYEKGKVIFKFEPVGPVYADYGYFENQELSANDYDIQ
FT                   NGIFFLKENISFKDDLFAKYSYFDNFYEYKGFYNETLRTFLHLDLNPSVGHYSTLPMTT
FT                   YVNGVQKVEYKNVPSSKLLNKLIHIYIVPDSENGNSIRHCFSREEWRNIQQSNPMYLLL
FT                   AKVQVREHTNVKDVVVMDARTRGGGISASLSTKAIDERVHGRQRYWDIGNWEGKAFYRN
FT                   GVLIVTLPKSILTEYGGTLSEEYAKEAIDKHVAYGTYCIIEWE"
     atgcagttgc aacctcataa agacctcgtt cgtagtggtc aaagaaatcg cgggtatgct        60
     attcgtattg ggaacaaagt tcctaagaat agtgccaacc ttgcatatgt acaatcaaaa       120
     tctgtatcac ccgaggagaa catcttatta gaagatgttt cttctcaaat taaagaaaac       180
     ggattatcta atttcataga gaaagattac atggtttacc cgaacaacaa gttcctgtta       240
     gagacagaat caggacaagc tatctttcct accgatgcag tatttgtaac agatgaattt       300
     actattcgta aaaaccgtca agatactcca aaaccagtat tctatcaaat ggaattgaaa       360
     ggacgcttcg atgcaagaac ttctcaggtt atcccttatc taggtggctt ctcttctgaa       420
     acagaacaag atgctattgc tttagaagat gtcgtactgg acaaaagaaa cgatctaatt       480
     tatgtaggga atagtattcg catagaagca aatggtggac ccatacagga agaggacgag       540
     tataaggttc aattaattcg tgaagataat ttcatttatc gtattgttgt agttacaaac       600
     ttccgtaacg acaaagatgt tacatacaaa gtagtttacc ctaactacag aaacgatatt       660
     aaacagagcg aactaaaaga agaagttctc aatgcgtatc catttttcga acaagtaacg       720
     atggatcagt ttgaagacat cgtttctcag atgggatctg atccggataa atacaagcat       780
     ttaaaagtgt acgcaattga agagaagggg aatgactttt ctttctatgc aacatctgat       840
     gttatgattg ccaactacca aacacgtact cctcaattat ttaagcaccg tgttgaagcc       900
     aaattaaaaa caaagcttag tgaaacaaac ccagggaaga tgaatattgg atttagcttt       960
     gttcaatcag tcgcaaatgt tgaaaactta tcttctattg gtaaggcgat caacgagcat      1020
     ttatctcttc ctaaatatgt ggagttacag aatccgcacc caacagaagt tgatcttttg      1080
     aagaaggata taggctactg ggctgttaat cttgatatgc cagaccatca ttatgaagat      1140
     tatgatttac ttgttatcac tggttacggt aaagctgact tatctatgtt taaagacaag      1200
     tttgagcatt acttaaaaaa tggcggtacg atttggatag acaatgcagg tagtggaatt      1260
     aatgttcttg atttcaaaac aagtaaagga aacacatttg tttctgatat tggattctca      1320
     tcgagcagca atgagtttgg agtaaaagaa attacgaaag actctccgta tacaagtcgt      1380
     ttattgccga ttaaaaatat cgaagcttta gggtatacgg acattgctcc tactatccta      1440
     tttggacaag atgaagaaag taagcagtgg gatgcagtag taaaacactt taatggtggc      1500
     ccttctatta ttaagaaaac attgtttgat aaaggtactg ttctggtttc taactgcggg      1560
     atattcagaa gcttttacca taatcaaaaa gagagcgtaa accttgtttt gaactcaatc      1620
     ctttaccact cagaagaaca atgggtgttt actccttgga gaaatgactt tgtatatcac      1680
     cgagataatt tattcgcgca agaatacaaa gtaaacaaca ctgacgttta tatcaatgat      1740
     agaagtgatt ataacgcaaa ccaaattgtc gctaagaaaa ttctttataa aaactgtaag      1800
     gaatatgtga aaatctattg caaaccttgg ttctataatg ctatcggaac atatgaacat      1860
     gccgtaaatg gtgataaatc tattccagtt aacaatagtg ggtttgaaag tggtcaggtg      1920
     gattccagtg gtaagcctat tgtttcttgg acatccgaca cagtgaatgc aataccttca      1980
     tggaatacta agaagttagc tggtcaaaca gtaacattca cacatgattc cgataagagt      2040
     ctattcggag ttcgtcaagt atctctaaat tcatcaaatg gaacaacagg cgctcatgcc      2100
     tattgggaaa gcgaagatat ctacttatct attgatgact acaaagtaac tgtatggaca      2160
     acaattgatc aggtacgagg ggttacaact gacggtatta agataggtgt atacaaccta      2220
     cagggagaac aaatctcttc ttcaatttct attacgggca agaaagattg ggttaaactt      2280
     gaaacgaatt tccacatcga caaacctcaa aacattaaga ttcgtttagg ttttgtagac      2340
     ggtaatggac tcggtaaagc aagctttgat aatgtcacac tagatacaat cggagcagtt      2400
     cgaggggttg cacagaatga gggagaaaaa actctctatg cattcagtat caagccaaac      2460
     gctacaacga ttgatatcga agcagaaggt tttgggaatg caaacattac aagagctact      2520
     ccagaagttt cattcacata cacgattatg ccatttatcc ttcaatggat ttcttacgga      2580
     atagattcag gaactggatt agaatatggt cgttatgagc gaatgtatgg accaccggtt      2640
     tcttattcta aagcaattcg taaaacagac ggcttaaaga atctaggata cttacatacg      2700
     ctgcttcctc cagtaccaag cgggaaacaa tggtatgaca agaacaagat cttctataag      2760
     attgcacttg gttcagaaaa cctagaagaa aacaattttg ttaacctaaa actatttgac      2820
     cgtaaaacag gtatggaatg gttctatagt ggtgatcttg ttattggcca taaagatatt      2880
     ttctgggcaa cagacaaacc aagttttgtt ctacatgctg aaactggttt cgaaacaatt      2940
     agagcctcta aaagaaactt cggattaaag ttaattgatg atcgtcgtat ctatagcgaa      3000
     cttccacaaa caaaggatgc taaagaaaac tggtatttaa gaatccataa cggacagttt      3060
     atcaaggacg gtctaggata taaggaatgg tcagaactac atgctagcaa taatcctgct      3120
     gtaatgaatc aatacaaaga acgagttatg aaaaaagaga agtatcaaat cgatgaatac      3180
     gcgtctcaaa ttttcaatcc ttctattgga attatgacag tagagaatga gatggaatac      3240
     cttactcctt ctacagtgaa agtacctcac aacaatctgt tcgtaagcca aggttttgta      3300
     gaaaaagaac agcttttagt tgagggatta gctaattctg tgggaacatt attccgagct      3360
     aaacaaaaag attggctccg taacgataaa gttcatatct ttatagatgt ttcaaataac      3420
     ggtaatattg tggagatttt tgaagagtat ccattcgaga ttaatctcga tgaaggtaca      3480
     gttttcttcc ctggccgaat cataactggc aaagtatatg caacttatga gcatcgcaat      3540
     ttccgtctgt ataagcgaat ctacaagaat actaaaatgt cgaacgacct tttagaaaat      3600
     aaacgaatcg attcagttac gaaagaagta atcatgtatg gttcaaaaga aaactggtta      3660
     attcagccga taccagttct taaaacaact aaaggcaagg caacatcagc caatacaatc      3720
     cctgcaacaa attatcgaat tgattatgag aaagggaaag taatctttaa gttcgaacct      3780
     gttgggcctg tatacgcaga ctatggttat ttcgagaatc aagagctatc agcaaatgac      3840
     tacgatatcc aaaatggaat cttcttctta aaagaaaaca tttcatttaa agatgatcta      3900
     ttcgctaagt attcttattt cgataacttc tacgaatata aaggtttcta caatgaaact      3960
     cttcgaacat tccttcattt agacctcaat ccatcagtgg ggcattactc aactcttcca      4020
     atgacaactt atgtgaatgg tgtccaaaag gtagagtata agaacgttcc atcttcaaag      4080
     cttctaaata agcttatcca tatttacatt gttccggatt ctgaaaacgg aaattcaatt      4140
     cgtcactgtt tcagtagaga agaatggaga aacattcagc agtcgaaccc tatgtacttg      4200
     ttacttgcta aggttcaagt aagagagcat acgaatgtga aagacgtagt tgttatggat      4260
     gcacgtactc gtggtggtgg tatctctgca tcattatcaa ctaaggcaat tgacgagaga      4320
     gtacatggaa gacaacgtta ttgggacatt ggaaattggg aggggaaagc attttataga      4380
     aatggtgtcc taattgtaac acttccaaaa tctattctaa ctgagtacgg cggtacatta      4440
     tctgaagaat atgcaaaaga agctattgat aagcatgttg cttacggtac ttattgcatt      4500
     atcgaatggg agtga                                                       4515
//

If you have problems or comments...

PBIL Back to PBIL home page