(data stored in ACNUC9435 zone)

EMBL: CP000904.PE61

CP000904.PE61        Location/Qualifiers
FT   CDS_pept        98101..98661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5496"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   gka:GK2884 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5496"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46485"
FT                   /db_xref="GOA:A9VV53"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV53"
FT                   /protein_id="ABY46485.1"
FT                   /translation="MFNILSTNVFTYKSKDGKTVTIREAKEQDAERMLNCASRALINAP
FT                   YMLSTVEDVKQMSVDAIQKTLKAYYENPNFVQFIAEVDSKLVGAIDFKNGNKEKISHQG
FT                   FFAMTILPEYRNYGIGRALLETLINWAKNNCKIEKVCLEVMEDNLGAIKLYKNQGFFEE
FT                   GRKAKGVKLDGGYQDLILMALFV"
     gtgtttaata tactatcaac taacgttttt acttataaat ctaaggacgg aaaaacagta        60
     acaattagag aagctaaaga acaggatgca gaaagaatgt taaattgtgc ttcaagagct       120
     ttaataaacg ctccatacat gctaagtacg gttgaggatg taaagcagat gagtgttgat       180
     gctattcaaa aaacgttaaa agcttattat gaaaatccaa attttgtaca gtttattgct       240
     gaagtggata gtaagttagt cggtgcaata gattttaaga acggaaacaa agaaaaaatt       300
     agtcatcaag ggttttttgc gatgaccata ctacctgaat atcgaaatta tggtattgga       360
     agagctcttc tagaaacgtt aatcaattgg gctaaaaata actgtaagat tgaaaaagtt       420
     tgtcttgagg taatggaaga taatttaggt gcaatcaagt tatataagaa tcaaggcttt       480
     tttgaagagg gtagaaaagc aaagggtgta aaattggatg gaggctatca agatttaata       540
     ttaatggctt tattcgtttg a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page