(data stored in ACNUC9435 zone)

EMBL: CP000904.PE63

CP000904.PE63        Location/Qualifiers
FT   CDS_pept        100656..101048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5498"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: oih:OB0471 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5498"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46487"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV55"
FT                   /protein_id="ABY46487.1"
FT                   /translation="MYNDSIYFPYINYDQCFDRQFPGPQIPGIPGMPGFPGVPSFPGQQ
FT                   SSQAPTSPPPSFIPQQSTASPFAVDPGAISLCLFRNTYIWLSNGEQFWYFPIFVGPRSV
FT                   AGFRWNGRFWVIFGIDTRRIISFTCF"
     atgtataatg attcaatata ttttccttat ataaattatg atcaatgctt cgatcgtcaa        60
     ttccctggtc ctcagattcc aggtatacct ggaatgccag gttttccggg tgtaccaagt       120
     tttccaggac agcaaagttc acaagctcca acatctcctc ccccatcatt tattcctcaa       180
     caatcaactg cttcaccatt tgctgttgat ccaggagcaa tttcattatg tttatttcga       240
     aatacttata tatggcttag taatggtgaa cagttttggt atttcccgat ttttgtagga       300
     ccaaggtctg ttgctggttt tagatggaac ggtaggtttt gggttatttt tggaattgat       360
     acgagaagga ttatttcatt tacatgtttt taa                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page