(data stored in ACNUC9435 zone)

EMBL: CP000904.PE64

CP000904.PE64        Location/Qualifiers
FT   CDS_pept        101102..101596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5499"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cac:CAC1508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5499"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46488"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV56"
FT                   /protein_id="ABY46488.1"
FT                   /translation="MKKFQSFDGTITMINDFVTGSNEDIGCNKLMSVDNGYGNLINFVV
FT                   KPNTYFIDYATVVVGDKVTGFYDANAPAPLIFPPQFQAIVMAKYTPHQNVKVDYFNEQL
FT                   ESSDGKLKLNISPSTQILLTNGQFFTGNLVNRNLIAIYSFTTMSIPAQTTPYKIIVLCQ
FT                   K"
     atgaaaaaat ttcaatcatt tgatggtaca ataactatga ttaacgattt tgtaacaggt        60
     tcaaacgaag atataggatg taataaatta atgtccgtag ataatggtta tgggaatcta       120
     ataaattttg tagtgaaacc aaatacgtat tttatcgact atgcaacggt agtagtagga       180
     gataaagtaa ctgggtttta cgatgccaac gctcctgctc ctcttatttt cccaccacaa       240
     tttcaagcga ttgttatggc aaaatataca ccgcatcaaa atgtaaaagt agactatttt       300
     aatgaacagt tggagagtag tgatggaaaa ttaaaattaa atatttctcc ttctactcaa       360
     attttattaa caaatggtca attctttaca ggtaatcttg taaatcgaaa tttaatagct       420
     atttatagtt ttacaacaat gagtatacca gctcaaacta caccatataa aatcattgtt       480
     ttgtgtcaaa agtga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page