(data stored in ACNUC9435 zone)

EMBL: CP000904.PE65

CP000904.PE65        Location/Qualifiers
FT   CDS_pept        102500..102934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5501"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_2264 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5501"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46489"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV57"
FT                   /protein_id="ABY46489.1"
FT                   /translation="MRLIETVHIKWYGLYSLNDFYNREEAFKKGIFAISRVYAKNETLI
FT                   YIGKTKRSFIQKIRELNKDWIFDESELKITLGIIESPSGESYSEKKVKEIKSLLILRHT
FT                   PVENNTSLLYHRGQFNLKIINKGRRGLIVKKISTGDLMWT"
     gtgaggttaa tagaaacagt acatattaaa tggtatggat tgtatagttt aaatgatttt        60
     tataatagag aagaagcttt taagaaggga atatttgcaa tctctagagt atatgctaag       120
     aatgaaacat tgatctatat aggaaaaacc aaaagaagct ttatacaaaa gataagggaa       180
     cttaataaag attggatttt tgatgaaagc gaattaaaga ttacattagg aataatagag       240
     tctcctagtg gtgaaagtta ctctgaaaaa aaggtaaaag agataaaatc ccttttgatt       300
     ttacgacata ccccagtaga aaacaacact tctttattgt accatagagg gcagtttaat       360
     ttgaaaatta taaataaggg aagaaggggc ttaattgtta aaaagatttc tacaggagat       420
     ctaatgtgga cgtaa                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page