(data stored in ACNUC9435 zone)

EMBL: CP000904.PE66

CP000904.PE66        Location/Qualifiers
FT   CDS_pept        103173..103874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5502"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bce:BC3186 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5502"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46490"
FT                   /db_xref="GOA:A9VV58"
FT                   /db_xref="InterPro:IPR009988"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV58"
FT                   /protein_id="ABY46490.1"
FT                   /translation="MGQGSRFQEKQQNRRKKVIFNIAFTLVLVTVGIVTYQLFSPSDTS
FT                   KKAIAQEKKATKIEEKKHKEKEAAQLEEKKREVKEAAQLEEKEREEREAALLEEKKREE
FT                   REAALLEEKQKAEKSVKTSENENKEGEKTASQEKGSQTNPSWKPIGTEQGAKPAMQFKE
FT                   GTADWSEMKKAISYAVDVPESQLIFDFIGNNGNNKAYGNVRDKQSNKKYKVDIDWVENQ
FT                   GWKPASVQVVK"
     atgggacaag gaagcaggtt tcaagaaaaa caacaaaatc gtcgtaaaaa ggtgattttt        60
     aatattgcat ttactttggt attagtgaca gttggtatag tgacatacca gttgttttcc       120
     ccttctgata catcaaagaa agcaattgct caagaaaaga aagcaacaaa gatagaagag       180
     aagaaacata aagagaaaga agcagcgcag ttagaagaga agaaacgtga agtgaaagaa       240
     gcagcgcagt tagaagagaa ggaacgtgag gagagagaag cagcactgtt agaagagaag       300
     aaacgtgaag agagagaagc agcactgtta gaagagaaac aaaaagcaga aaaatcggta       360
     aaaacgagcg aaaatgaaaa taaagaggga gaaaaaacgg catctcaaga aaagggttct       420
     caaactaatc cttcttggaa gccaattggt acagagcaag gagcaaaacc tgcaatgcaa       480
     tttaaagaag gaacagcaga ttggagtgag atgaaaaaag caatttctta tgctgttgat       540
     gttccagaga gccaattgat tttcgatttt attgggaata atggtaataa taaagcctac       600
     ggtaatgtac gggataagca aagtaataaa aaatataagg ttgatattga ttgggtagag       660
     aatcagggtt ggaaaccagc atctgttcaa gtggtaaaat aa                          702
//

If you have problems or comments...

PBIL Back to PBIL home page