(data stored in ACNUC9435 zone)

EMBL: CP000904.PE68

CP000904.PE68        Location/Qualifiers
FT   CDS_pept        106631..107071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5506"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46492"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV60"
FT                   /protein_id="ABY46492.1"
FT                   /translation="MNLNKLIVSCGVISALTFGVLGNNAYAEEVQKSNDAINVIEHVPT
FT                   DLLLTQTLDYTGEAVTSFVYKGSTDLSFFIKNNGQNKMGYSVKGPNKEPIVGGYIKPGE
FT                   QKINVTNVRNALSPLPVGTYKIYVSNDDGSTGQFQVAVNSLD"
     atgaatttaa ataaattaat agttagttgt ggagtaattt cagcattaac atttggcgtg        60
     ttaggtaata atgcttatgc tgaagaggta caaaaatcaa atgatgcaat caatgtaatt       120
     gaacatgttc ctacagacct attattaact caaacactgg attatactgg agaggctgta       180
     acttcttttg tatataaggg gagtacagat ttaagctttt ttataaaaaa taatggtcaa       240
     aataaaatgg gatatagcgt aaaaggtcca aataaggagc ccatcgttgg tggttatata       300
     aaaccgggtg aacaaaaaat taatgttaca aatgtgcgga atgctttatc tccattaccg       360
     gtgggaacat ataaaattta cgtttcaaat gatgatggat ctacaggaca attccaagtt       420
     gcggtaaact ctttggatta a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page