(data stored in ACNUC9435 zone)

EMBL: CP000904.PE69

CP000904.PE69        Location/Qualifiers
FT   CDS_pept        107386..108219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5507"
FT                   /product="VanW family protein"
FT                   /note="PFAM: VanW family protein; KEGG: bce:BC2985
FT                   vancomycin B-type resistance protein VanW"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5507"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46493"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV61"
FT                   /protein_id="ABY46493.1"
FT                   /translation="MNIVNLRPKQRSKYRIMLGTWYYSTKRYIQWLADGKTYAKTLQQE
FT                   KLPCTAIQHRTILLRKLKDVDMWYQQNKVVNLKIAIKQLDGIVIRPGETFSYWRLIGKP
FT                   TRRKGYVEGMILHYGSFQAGIGGGLCQLSNLIYWMTLHTPLTVTERYRHSFDVFPDSKR
FT                   TQPFGSGATCSYNYLDLQIKNETDQSYQLHLYITEKHLVGEWRTAYPQLYQYEVYEKEH
FT                   SIQSAYWGGYIRHNVIQRRVYSQQKQFVEDQYVTENHAIMMYEPLLACNNEESGD"
     atgaatatag tgaacttacg tcctaaacag cgttctaagt atcgtattat gctaggaaca        60
     tggtattact ctacaaagag gtacatccag tggttagcag acggaaaaac atacgcaaaa       120
     actttacaac aagaaaagtt accctgtaca gcgattcagc accgaacgat actacttcgt       180
     aagctcaagg atgtagatat gtggtatcaa cagaataaag ttgttaattt aaagattgcc       240
     attaaacagc tagatggtat cgtcattaga ccgggagaaa cattctctta ctggcgttta       300
     ataggtaagc ctactaggag aaaagggtat gtagaaggta tgatactaca ctatggatct       360
     tttcaagcag gcattggagg agggctttgt cagctttcaa atttaatata ttggatgacc       420
     ttacatacac cactgacagt aacagagcga tatcgtcata gctttgatgt ctttcctgat       480
     tccaagcgga cccagccgtt tggaagcgga gcgacttgtt cctataacta tttggactta       540
     caaattaaaa atgaaacgga ccaatcgtat caacttcacc tttatatcac agagaaacat       600
     ttagttggtg aatggagaac agcctatccg cagctttatc aatatgaagt ttatgaaaaa       660
     gaacactcaa tccaatctgc atactggggt ggttatatac gacataatgt tattcaacgt       720
     agagtatata gccaacagaa acagtttgta gaagatcaat atgtaacgga gaatcacgct       780
     ataatgatgt acgaaccatt attagcttgt aataacgagg aaagtggaga ttaa             834
//

If you have problems or comments...

PBIL Back to PBIL home page