(data stored in ACNUC9435 zone)

EMBL: CP000904.PE7

CP000904.PE7         Location/Qualifiers
FT   CDS_pept        15649..19167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5439"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cac:CAC1879 uncharacterized, phage-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5439"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46431"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUZ9"
FT                   /protein_id="ABY46431.1"
FT                   /translation="MEKELIFPVPYSEFDRKKDAEYDGDPNGDYVMAEDVNELQESIEK
FT                   IERVINFTELESTVSDELNKKVDKATMSDFGSPLFVGYRGASINAYDSIEKRINAFSYI
FT                   PHVMINKEESTNFDFFVNEVKKSGTLLYGIINYSDVILNNIEANITWFQSKGFHGVLLP
FT                   GFGFENGWNRSQQNQILQYIHARGMVAVITGEIDTTLFNKPHKNNPQQADLKTSKDDIY
FT                   LAQDVFVLNGAKNNPIVIPSVVFNLNKAQKERGIQIFVEDTADASSDNNKLYLYGKMLS
FT                   TLYNLDGYSLVPKSRYALNEKVERYLHGFELGKWKTQNPIYVEEATATSRSFSKGSILF
FT                   DKVKNECYIKGVGLNPSIYTWQDKQIPGNAIDFASAIYGSEGVKTLVDAINNNDHKIHY
FT                   SKIDGMEEGGVTPDLFKDTVIRAINNSPAAVAKNPPKGYDELAGNNFIHGGVIDYIDAG
FT                   SIKSGILNIDAIKTNIIEAINAYIGTAKINTAVIGELSADHIAANVIDAINIYATNISS
FT                   SSAKINTAVIGELSSDHIKGAVIEAVNLYAGEAVIDSAKIGQLDADHIKATVIEAINAS
FT                   IETAVIDSAKIGTLTASHIKGMVVEAINLYAGQAKIDAAQIGALKADNISAGLIEALEI
FT                   SAGSADFDRLQASVIDAINASIEHAFIDGAIIGEGTVDSAQIADGSITDAKIVSLVANK
FT                   IVAGTIDTGQVTLQGTNGHLRITGNRLQVFDNQKTPIERVSIGDVNADGTLYGLRVRGA
FT                   DGVTVLYDEKGVYSEGITDGAITNPKIQEGAVDGGKHIAANTVTADKLVAEAITTRELA
FT                   AKSVNANHLQVGAIVAGSGVIGEAAIGEAEIAQASITDAHIKKLSADSVSAGSLQIQSR
FT                   NLVSNSTLRKGLLDWTTDPILDIAEVSEVVRLNTTNSMHLFTTGKQTQNLSAYSKFVPA
FT                   SPGENYSASVYVLTKNILNYDGGHPRVEIEYFNDSARISSKNTAAQLTSNDLWQRISIT
FT                   EVAPAETTRVRLRIYHPKNGDSYFCRPMLQKGNIITEWTGDGSYMTEDGFYTGDLHAKQ
FT                   IKVGKIKAEMLQIGPDTEFEPGYSPGELREEMKDRIPYRVEILSTNGIAFKGGNISTTL
FT                   KANVYLGAENVTDQMDAIRFKWMRVGRNGEDDLVWNAAHKGLKEVPITRDDVYQRATFL
FT                   CEVLDS"
     atggaaaaag aattgatttt ccctgtgcct tattctgagt ttgaccgtaa aaaagatgca        60
     gagtatgacg gagatcctaa tggtgattac gtcatggctg aagatgttaa tgagcttcag       120
     gagtctattg aaaagataga aagagtcatt aactttacag aactagaaag cacagtctca       180
     gatgaactaa ataaaaaagt tgataaagca actatgtctg attttggtag tccattattt       240
     gtggggtata gaggcgcgtc catcaatgca tacgatagta ttgagaaacg aatcaacgct       300
     tttagctaca ttcctcatgt catgattaac aaagaagaat ctactaactt tgatttcttt       360
     gttaatgaag ttaagaagag tggaacattg ctatacggta ttatcaatta ttcagatgtt       420
     attttaaata acattgaagc caatataaca tggttccaat ctaaaggttt tcatggagtg       480
     ttactacctg gtttcggatt cgaaaacgga tggaacaggt cacaacaaaa ccaaatcctt       540
     caatatattc atgcaagagg aatggttgct gttattacag gtgaaattga taccacttta       600
     tttaacaagc cccacaaaaa caatccccaa caagcagacc ttaaaacatc aaaagatgac       660
     atctatctag cacaagatgt tttcgtttta aatggtgcta aaaacaatcc tatcgtaatt       720
     ccttccgttg ttttcaatct aaacaaagct caaaaagaaa gaggaattca aatctttgtt       780
     gaagatacag ccgatgcaag tagtgataac aataagcttt atttatacgg aaaaatgtta       840
     tctacactgt ataacttaga cggatatagt ctcgttccta aaagccgata cgccttaaat       900
     gagaaggtag aaagatacct tcatggtttt gaattaggga aatggaaaac acagaatccg       960
     atttatgtag aagaagcaac tgctacatcg cgttctttct ctaaaggaag cattctattc      1020
     gataaagtga aaaatgaatg ctacataaaa ggagtagggt taaacccttc catctacaca      1080
     tggcaagata aacaaatccc tggtaatgca attgatttcg caagtgctat ttatggttct      1140
     gaaggtgtaa aaactcttgt tgatgcaatt aataataacg accataaaat ccactattcg      1200
     aagattgatg gtatggaaga gggtggcgta acacctgatc tatttaagga tactgttatc      1260
     cgagcaatca acaactctcc tgcagccgta gctaaaaacc caccaaaagg atatgacgag      1320
     ttagctggta ataactttat tcacggtgga gtcattgact atattgatgc aggttctatt      1380
     aagtcaggga tacttaatat cgacgcgatt aaaacaaata tcattgaggc gatcaatgct      1440
     tatattggta cagctaaaat caatacagcc gttattggtg aattatcagc agatcatatc      1500
     gcagccaatg ttatcgatgc aatcaatatt tatgctacaa atatttcttc tagttcagct      1560
     aaaatcaata cagctgttat tggtgaatta tcatcagatc atatcaaggg agcagttatt      1620
     gaagctgtta acttatatgc aggagaagcg gtaattgatt ctgcaaagat cggtcaactt      1680
     gatgcggatc atatcaaagc aactgtaatt gaagcgataa acgcgtctat tgaaacggct      1740
     gtaatcgatt cagctaagat tgggacatta actgcaagtc atattaaggg tatggttgtt      1800
     gaagctatta acctttatgc aggacaagca aaaatcgatg ctgctcaaat tggtgcttta      1860
     aaagcagata atatttcagc aggattaatt gaggccttgg agatctcagc aggaagtgcg      1920
     gacttcgata gattgcaagc ttctgtaatt gatgctatta atgcaagtat cgaacatgct      1980
     tttattgatg gagctattat tggtgaaggt acagttgact ctgctcaaat tgcagacggt      2040
     agtatcacag atgcaaagat tgttagctta gtagctaata agattgttgc aggtactatt      2100
     gatactggac aagttaccct acagggaaca aatggccatt taagaattac gggtaataga      2160
     ttacaagttt ttgataatca aaaaacccct attgaacgtg tatccattgg tgatgttaac      2220
     gctgatggaa ctctttatgg attacgtgtc cgtggtgctg atggagtaac tgttctatac      2280
     gatgaaaagg gtgtttactc agaaggtatc actgatggag ctatcaccaa tcccaaaatc      2340
     caagaaggtg ctgttgatgg tggaaagcat attgcagcta acacggtcac agccgataag      2400
     ctagttgctg aagccataac aacacgagaa ctagctgcga agtctgttaa tgctaatcac      2460
     ttgcaagtag gtgccatcgt tgcaggtagt ggggttattg gagaggccgc tattggtgaa      2520
     gcggaaatcg cacaagctag tattacagat gctcacatta aaaagctaag tgctgatagt      2580
     gtttctgcag gttctcttca aatccaaagt cgaaatctag tatctaattc aacacttaga      2640
     aaaggattgc tagattggac tactgatcca atactagata tcgctgaggt aagtgaagtt      2700
     gttcgtttga acacaacaaa tagtatgcat ttatttacca caggaaaaca gacacaaaat      2760
     cttagtgcat attctaagtt tgtccctgca agccccggtg aaaactactc tgcttctgta      2820
     tatgtcctca caaaaaatat cctcaattat gatggcggac accctagagt tgaaatcgag      2880
     tatttcaatg actcagcccg tatctcatcc aaaaatactg cagctcaatt aacaagcaat      2940
     gatctgtggc aacgtatcag tattacggaa gttgctcccg cagaaacgac aagagttcgt      3000
     ttacgaatct atcatcctaa aaacggagat tcatacttct gtagaccaat gctccaaaag      3060
     ggtaacatca taacagaatg gactggtgac ggttcataca tgacagaaga tgggttctac      3120
     acaggagact tacatgcaaa acaaataaag gttggaaaga ttaaggctga gatgcttcaa      3180
     attggacccg atacagaatt tgaaccaggt tatagtcctg gtgaacttcg tgaagaaatg      3240
     aaagaccgca ttccttatcg tgtagaaata ctgagcacaa atggaatcgc ctttaagggt      3300
     ggaaacatct ctacaacact taaagcgaat gtatatttag gtgctgaaaa tgtaactgac      3360
     caaatggatg ctattcgttt taagtggatg cgcgtaggta ggaatgggga agatgaccta      3420
     gtttggaatg ctgctcataa aggattaaaa gaagttccta ttacaagaga tgatgtatat      3480
     caaagagcta catttttgtg tgaagttttg gatagttaa                             3519
//

If you have problems or comments...

PBIL Back to PBIL home page