(data stored in ACNUC9435 zone)

EMBL: CP000904.PE70

CP000904.PE70        Location/Qualifiers
FT   CDS_pept        complement(108739..109089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5508"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: cps:CPS_1684 glyoxalase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5508"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46494"
FT                   /db_xref="GOA:A9VV62"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV62"
FT                   /protein_id="ABY46494.1"
FT                   /translation="MKLGHIMIFVNDMTKARWFYSELLGLKTLLEQENKLVFALDGCQL
FT                   IAFKCEKTKEIGDYSNEARTVLVFEVVSVEQTYKELKEKGIQFLHDKPTQGRYAAFVDP
FT                   FGNVHEIAESFG"
     atgaaactag gacatataat gattttcgtc aatgacatga caaaggcgag atggttttat        60
     tctgaattgc tgggtttaaa aacattgtta gagcaagaaa ataagcttgt atttgccctt       120
     gacggctgtc agcttatagc ttttaagtgt gaaaagacca aagaaattgg agattattca       180
     aacgaggcta gaacagtttt ggtgtttgag gtcgtatctg ttgagcaaac ttataaggag       240
     ctgaaggaaa agggtattca atttttgcat gataaaccta ctcaagggcg atatgctgct       300
     ttcgtagatc cgtttggtaa cgtgcatgaa atcgctgaat cgttcggatg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page