(data stored in ACNUC9435 zone)

EMBL: CP000904.PE71

CP000904.PE71        Location/Qualifiers
FT   CDS_pept        109525..110193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5509"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: bca:BCE_3336
FT                   IS240 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5509"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46495"
FT                   /db_xref="GOA:A9VV63"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV63"
FT                   /protein_id="ABY46495.1"
FT                   /translation="MNRQNSFKWKHYQPDIILLTVRWYLRYNLSFRDLVEMMEERGLSI
FT                   AHTTIMRWVHQYSPELDKRVRRYLKKTKDSWRGDETYVKVKGKWMYLYRAVDSEGNTID
FT                   FYLSKNRNAKSAKRFLKKALASCHSVTPRVITVDKNLAYPVAIKALHEEKSMPIGVKLR
FT                   QIRYLNNIVEQDHRFIKKRIRTMLSLKSFRTAKWILAGIEAMHMMKKDKPLKRSLSKIK
FT                   "
     gtgaataggc aaaattcgtt caaatggaag cactatcagc ctgatattat tttgctaaca        60
     gtaagatggt acctacggta caatctaagt tttcgtgatt tagtggaaat gatggaggag       120
     cgaggtttgt ccattgctca cactaccatc atgcgatggg tacatcaata tagccctgag       180
     ttagacaaac gagttcgacg ctatttaaag aaaaccaagg attcttggag aggcgatgag       240
     acatatgtaa aagtcaaagg gaaatggatg tacttgtatc gtgctgtgga ttctgaagga       300
     aataccatcg atttttatct gagcaagaat agaaatgcta aatcagccaa gcgcttcttg       360
     aagaaagcct tggcttcctg tcattccgta acacctcgag tgattacagt cgataagaac       420
     ctagcatatc ctgttgctat caaagcatta catgaagaaa aaagcatgcc gataggtgtg       480
     aagttgaggc aaattcggta tttaaataac attgtggaac aggatcaccg ctttatcaag       540
     aaacgcatac gtactatgtt aagtttaaag tcctttcgga ctgccaaatg gattcttgct       600
     gggattgaag ccatgcatat gatgaaaaaa gacaaacctc tcaagagaag tctgtccaaa       660
     atcaagtga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page