(data stored in ACNUC9435 zone)

EMBL: CP000904.PE72

CP000904.PE72        Location/Qualifiers
FT   CDS_pept        110443..112608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5510"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: baa:BXA0164 protective antigen"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5510"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46496"
FT                   /db_xref="GOA:A9VV64"
FT                   /db_xref="InterPro:IPR035088"
FT                   /db_xref="InterPro:IPR037149"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV64"
FT                   /protein_id="ABY46496.1"
FT                   /translation="MKKLKPALSVLGSVSMALTLAYPALADIKQPNAGSTIEMFKEDAN
FT                   AKEGKDLIYGTDGKKGKMSTEKIEIQNNDWDQDGISNDLEIRGYKIEFNRQTGKNEAQA
FT                   WDPERDKDKLKFITNPMSANSDGDPFTDAYEVQYYGSNSDTEFNPMVANIPNLQVGIKR
FT                   IGVTPLAAITDSNGGSIDKGWEKSVSTQHSFGVGAGVEGGVEGSAAGPVPSGKASLNVS
FT                   YGYSKTSTDTERYSSNIDWSTAKTVDSAKAAKVSLQLEYKNTGTASAQNVSPHFNIRLG
FT                   DKIISTVKATQDRYKANQLSTEKGGRNTTEVLIDSVDNQADVNIYLSLDELKAVEQGAI
FT                   LSVEVLPTSTMELYIEKDGEFMNLGDSGKFESRVNASTTILETDIGNKPKFRMYAPEGV
FT                   GSDTNLTFNEVLKHVKVDSTKINEFIDNSRGDQVIVAKENLENAKKSYVSKGAKVGVFT
FT                   KIQQPELSYSAYDPFTKKFYAAVVPGLFGASNEVSVSFENKKSKQTQQVTLLRKGNVYE
FT                   SKEAVSLNDFNPSQKVTFEINDAQKKLPIQKISTVVTYNKEYENYLTHRFSDELIVEGT
FT                   PYTMKASGNPVLSYKGNDKWQYLAYAGNYTQPVNVIIERKGQPKPGQPIKKGEDIHIKV
FT                   QNSAYSGYEYLKLQNGYIHFDQKQNASTFKFNHIHSPGSLDYQREWNLQSDGNNIGLDK
FT                   GGSGYVTYGNDVHTGSSLNRWSFDKAK"
     atgaagaaat tgaagcccgc acttagtgta ttaggtagtg tatcgatggc actgacctta        60
     gcatatcctg ctttagcaga cataaaacag ccgaatgcag gaagcacaat tgaaatgttc       120
     aaagaggatg caaatgcaaa agaaggaaaa gatcttatct atggaactga tggaaaaaag       180
     ggaaagatgt ctactgaaaa aattgaaata caaaataacg attgggatca agatggtatt       240
     tctaacgact tagaaataag aggctataaa attgagttca atcgacaaac cgggaaaaat       300
     gaagcacagg catgggatcc agagcgagac aaagataaat taaaatttat tacaaatcct       360
     atgagcgcga attcggatgg agatcctttt acagatgcat atgaagttca gtattatggc       420
     agtaactctg atactgagtt taatccaatg gttgcaaata taccgaattt gcaggttggt       480
     ataaaacgta ttggggttac tcctcttgcg gctattacgg attcaaacgg tgggtccatt       540
     gataaaggtt gggaaaaaag tgtatcgaca caacattcgt ttggtgtagg agcaggtgtc       600
     gaaggtggtg tggaaggttc cgcagccggt cctgttcctt ctgggaaggc ctcattaaat       660
     gtaagctatg gatactcgaa aacatcaaca gataccgaaa gatattcttc taatatagat       720
     tggtctaccg caaaaactgt tgattcagca aaagcagcaa aagtgagctt acagttagaa       780
     tataaaaata cagggacggc gtctgctcaa aatgtttctc ctcattttaa cattcgttta       840
     ggggacaaga ttatcagtac agtaaaggca acacaagatc gttataaagc aaatcagtta       900
     agtacagaaa aaggtggaag aaatacaaca gaagtattga tagacagtgt agataatcaa       960
     gcagatgtaa atatttactt gtcgttagat gaattgaaag ctgttgaaca aggtgcaatt      1020
     ctttctgttg aagtactacc tacgagtaca atggaattgt atattgagaa agatggagaa      1080
     tttatgaatt taggagattc aggaaaattt gaatctcgtg taaatgcttc gactacaata      1140
     ctagagactg atatcgggaa caaaccgaag tttagaatgt atgcaccaga aggtgttggt      1200
     agtgatacaa atttaacgtt taacgaggtt ctgaagcatg ttaaagtaga ttctacaaag      1260
     ataaatgaat ttatagataa tagcagagga gatcaagtta tcgttgcgaa agagaatcta      1320
     gaaaatgcta aaaaatctta tgtttcgaaa ggcgcaaaag tcggtgtttt cacaaaaatt      1380
     cagcaaccgg aattgtcata tagtgcttat gatccattta cgaaaaagtt ttatgcagca      1440
     gtcgtacctg gcttattcgg agcgagtaat gaagtctctg tttcttttga aaataaaaaa      1500
     tccaaacaaa cacaacaagt aacattattg agaaaaggaa acgtatatga gtctaaagaa      1560
     gctgtaagtt tgaatgattt caatccatca caaaaagtta catttgaaat caatgatgca      1620
     caaaagaaac ttccgataca aaaaatctct acagttgtta cgtataataa agaatatgaa      1680
     aattatttga cccatcgatt cagcgacgaa cttattgtag aaggaactcc ttatactatg      1740
     aaggctagtg gaaatcctgt gcttagttat aaaggaaatg ataaatggca atatcttgcg      1800
     tatgctggga attacactca accagttaat gtaattattg aaagaaaagg gcagcctaaa      1860
     cctggacaac caatcaaaaa aggtgaagat atacatatta aagttcaaaa tagtgcttat      1920
     tcaggctatg aatatttaaa acttcaaaat ggttatatcc attttgacca aaaacaaaat      1980
     gcaagtactt ttaaatttaa tcatatacat agcccaggca gccttgatta ccagagagaa      2040
     tggaacctac aatctgatgg taacaatata gggttagata agggtggatc tggttatgtg      2100
     acatatggta atgatgtgca tactggttcg tctttaaata gatggagttt cgacaaagct      2160
     aagtaa                                                                 2166
//

If you have problems or comments...

PBIL Back to PBIL home page