(data stored in ACNUC9435 zone)

EMBL: CP000904.PE73

CP000904.PE73        Location/Qualifiers
FT   CDS_pept        113459..114169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5511"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: pth:PTH_0245 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5511"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46497"
FT                   /db_xref="GOA:A9VV65"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV65"
FT                   /protein_id="ABY46497.1"
FT                   /translation="MKKILIVEDEENIREVCKRYLEREEYEVYTAVNGTEGWDVFLTHQ
FT                   PDLIILDLMMPKKDGWELCGEIRQQSNVPIIMLTAKGEERDRILGLTMGADDYLTKPFS
FT                   PRELVLRVQIILRRGNQVAIQAKESLSEVIEFPDLKIYPKTRCVLVCENEVELTVKEFE
FT                   VLYVMAKHPKQVFSRSQLLELIWDFGHEGASNTVTVLVSRLREKLEKHTIKNHWIHTVW
FT                   GIGYRFEPNGRNES"
     atgaaaaaaa ttttaatcgt agaagatgaa gaaaatattc gagaagtctg caaacggtat        60
     ttagaaagag aagaatatga agtatatacc gctgtaaatg gtacagaagg ttgggatgta       120
     tttcttactc atcaaccaga tttaattatt ttagatttga tgatgccgaa aaaagatgga       180
     tgggaactat gcggggaaat tcgtcaacaa tcaaatgtcc ctattattat gttaactgct       240
     aaaggggagg aaagggatcg aattttaggc ttaacaatgg gagcagatga ttatttaaca       300
     aagccatttt cccctcgtga attagtatta agggttcaaa ttatactaag aagaggcaac       360
     caggtagcga tacaagcaaa agaatcccta tcggaagtga tagaatttcc agatttaaaa       420
     atatatccaa agacaagatg tgtacttgtt tgtgaaaatg aagtggagtt aacggtgaaa       480
     gagtttgagg tactttatgt catggcaaaa catccaaaac aagtattttc tcgctcgcag       540
     cttcttgaat taatttggga ttttggacat gaaggggcat caaacacagt tactgtgcta       600
     gtgagtcgtt tgcgtgaaaa gctcgagaag catacgataa agaatcattg gattcataca       660
     gtttggggta taggatatcg ctttgagcca aatggaagaa atgaatcatg a                711
//

If you have problems or comments...

PBIL Back to PBIL home page