(data stored in ACNUC9435 zone)

EMBL: CP000904.PE74

CP000904.PE74        Location/Qualifiers
FT   CDS_pept        114166..115245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5512"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: ssa:SSA_1114 histidine
FT                   kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5512"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46498"
FT                   /db_xref="GOA:A9VV66"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV66"
FT                   /protein_id="ABY46498.1"
FT                   /translation="MRLRIQLLLMNLLSTSILVIAIWYSETKMLLEPEQTRLLTVIAVV
FT                   GLIISTFIYWLMTRPIMRSIKNLMTLTKQFSDRQFETMYIIGKEPREFKELATSFQQMA
FT                   KKLEEGFTQLEEGEKARKELITNISHDLRTPMASIQLMIEALQDNLIEDPEMRKQYLAT
FT                   ILKEIERLSGLINDLFELSKLEFEQVDFYPSFTHIDKVLLDVLESHSVLLEDKQIDLQL
FT                   QVPDRLPRLLIMPCKIARVIGNLLDNAIRYSPVSGTIELIVEENKQNQQVQFILRDEGE
FT                   GISPNDQLRVFERFFRTDQSRSSQSGGSGLGLAIAKSLIEMHKGEIGVRDRADGKQGSE
FT                   FWFTLPITSEKNKTAERLL"
     atgagattac gtattcaatt gttactcatg aatttattaa gtaccagtat cctggtaatt        60
     gctatatggt atagtgagac gaaaatgtta cttgaaccgg aacaaacacg gttattaaca       120
     gtaattgcgg ttgtaggact gattatttca acgtttattt actggttaat gacacgccct       180
     atcatgaggt ctatcaaaaa tttaatgaca ttaacgaagc aatttagtga tagacaattc       240
     gaaacaatgt atataattgg aaaagaacca cgggagttta aagaattagc aacatcgttt       300
     caacagatgg caaaaaaatt agaagaaggg tttactcagt tagaagaagg ggaaaaagcc       360
     cgcaaggagc taattacgaa tatttcacac gacttacgaa cgcctatggc tagcatacaa       420
     ttgatgatag aagcgttaca agataacctg attgaagatc ctgaaatgag aaagcaatac       480
     ttagcgacga tcttaaaaga aatagaaaga ttaagtggat taatcaatga cctatttgaa       540
     ctttcaaagt tagagtttga acaagtagat ttttatccaa gtttcacaca tatagataaa       600
     gttctattag atgtattaga gtcacattct gtcttattag aagacaaaca gattgattta       660
     caattgcagg ttcctgatag attacctcga ctattaatta tgccgtgtaa aatagcaagg       720
     gttataggta atttattaga taatgctatt cgatattccc ctgtctctgg aacaattgag       780
     ttgattgtag aggaaaataa gcaaaatcaa caagtccagt tcattctgcg tgatgaagga       840
     gaaggaattt ctccaaatga ccaactacgc gtatttgaac gattttttag gacagatcaa       900
     tcaagaagtt cacaatctgg agggtccggt cttggactag ccattgcaaa atcattgatt       960
     gaaatgcaca aaggggaaat tggtgtgagg gatcgcgcag atggtaagca gggaagtgaa      1020
     ttttggttta ctcttcccat cacatcagaa aaaaataaga ccgctgaaag acttttgtaa      1080
//

If you have problems or comments...

PBIL Back to PBIL home page