(data stored in ACNUC9435 zone)

EMBL: CP000904.PE75

CP000904.PE75        Location/Qualifiers
FT   CDS_pept        115323..115826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5513"
FT                   /product="secreted protein"
FT                   /note="KEGG: sco:SCO0153 secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5513"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46499"
FT                   /db_xref="GOA:A9VV67"
FT                   /db_xref="InterPro:IPR019545"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV67"
FT                   /protein_id="ABY46499.1"
FT                   /translation="MKRKYVWLIGGSIILVLILWSLFRPEKLFIDKKVNETLPQTEMQS
FT                   MKTKQVQDQVQVISAGQFQNGVHETTGTATIHQLADGKRILRLSNFSTSNGPDVRVVLV
FT                   PTDRLKNNEDVKNHQYIELGKLKGNKGNQNYEIPEGIDVSTYGSVSVWCKRFNENFGAA
FT                   YFKK"
     atgaaaagaa aatatgtatg gcttataggt ggttccataa ttctcgtgtt aattttatgg        60
     tctttgttcc gaccggagaa attatttatt gataagaaag tgaatgaaac attgccacag       120
     acggaaatgc aatcaatgaa aacaaaacaa gttcaggatc aagttcaagt tataagtgca       180
     ggtcagtttc aaaacggtgt ccatgaaaca actggaacag caacaatcca tcaattagcg       240
     gatggaaaac gcattttacg actttctaat ttttcaacat ctaacgggcc agatgtgcga       300
     gtagtattag ttcctacaga tcgtttgaaa aataatgaag atgttaaaaa tcatcagtat       360
     attgaattag gaaaattaaa gggaaacaaa ggcaaccaaa actatgaaat tcctgaaggg       420
     atagatgtaa gtacatatgg ttcagtttct gtttggtgta agagatttaa tgaaaacttt       480
     ggtgctgctt attttaaaaa gtaa                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page