(data stored in ACNUC9435 zone)

EMBL: CP000904.PE76

CP000904.PE76        Location/Qualifiers
FT   CDS_pept        116476..117219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5515"
FT                   /product="Collagen triple helix repeat"
FT                   /note="PFAM: NHL repeat containing protein; Collagen triple
FT                   helix repeat; KEGG: btl:BALH_p0036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5515"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46500"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR021201"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV68"
FT                   /protein_id="ABY46500.1"
FT                   /translation="MFLGGGYMERKNKWYGLNSNVNLSASSFDPNLVGPTLPPISPISV
FT                   PTGPTGETGITGPTGPTGPTGPTGVTGITGPTGPTGATGITGPTGPTGETGITGPTGPG
FT                   PTVSLKFLYVANFNENTVEIYDIFNPIFPVRIGEFNGGNLANPAGLAITGTTLYVTNNG
FT                   DNTVEIYDILNPIAPVHVGEFNGGNLSEPDGLAITGTTLYVANFNDNTVEIYDILNPIA
FT                   PVRVGEFNAGNLSSPAGLIIFSLFG"
     gtgtttttag gggggggata tatggagagg aaaaataaat ggtacggatt aaactctaat        60
     gtaaatctat ctgcaagttc atttgatcct aacttggtag ggcctacatt gccaccgatt       120
     tcaccaattt ctgtaccaac cggtccaacg ggagaaacag gtataacagg cccaacaggc       180
     ccaaccggtc caaccggtcc aacgggagta acgggtataa caggcccaac cggtccaacg       240
     ggagcaacag gtataacagg cccaaccggt ccaacgggag aaacgggtat aacaggccca       300
     actggaccag gtccaactgt gagtcttaaa tttctttatg tagcaaattt taatgaaaat       360
     acggtagaaa tttatgatat tttcaatcca atatttccag tacgtattgg agagtttaat       420
     ggtgggaatt tagctaatcc tgctggatta gctattacag gaaccactct ttatgtaaca       480
     aataatggag ataacacggt agaaatttat gatattttga atccgatagc tccagtacat       540
     gttggagagt ttaatggtgg aaatttaagt gaacctgatg ggttagctat tacaggaacc       600
     actctttatg tagcaaactt taatgataat acggtagaaa tttatgatat tttgaatccg       660
     atagctccag tacgtgttgg agagtttaat gcaggaaatt taagtagtcc tgctggatta       720
     atcatttttt cgttattcgg ttag                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page