(data stored in ACNUC9435 zone)

EMBL: CP000904.PE77

CP000904.PE77        Location/Qualifiers
FT   CDS_pept        118528..120342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5518"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: dsy:DSY1105
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5518"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46501"
FT                   /db_xref="GOA:A9VV69"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV69"
FT                   /protein_id="ABY46501.1"
FT                   /translation="MPEPLKKNSRYMVGLDSLRGLAILGVILYHINFNWMPGGFLGVTV
FT                   FFVLSGYLITDILAIEWKNNKRIDLKKFWLSRARRLLPGMLIMLIVTLAWITIFHSSLL
FT                   VKMRGDSLAALLYFSNWWYIYHKLSYFDSFSQLSPLNHFWSLAVEEQFYVVWPFVISLG
FT                   FYYIKKQSRMILFICLGAIASALAMAILYEPGTDPSRIYYGTDTRAFSLLIGAALALIW
FT                   PSSRLASKIIPQARLILDIIGGVALIIILTMFWKTNQYEPFLYRGGMVLLSIATALLVA
FT                   NLAHPASRIAQFLRFRPLRWMGVRSYGIYLLHYPIITLTTPKVNTGEFSFTRAILQFLL
FT                   IIIVAQISWKFIENPIRKGALKNIRIKNLKIRNLTLSGKLVLICAVFISSIATFGLTTA
FT                   SKAKENTQKDKVEAVQEEQAKHPVAVWEKPADEPPQNKEEQKEENPAQPKDPLTVTAVG
FT                   DSIMIDIAPYLKNTFPNIRIDAKIGRQMSQAIPAVEQLKNEGNLGSNVIIGLGTNGAFT
FT                   KEQLASLIEVIGNERKIILINTRVPRPWESLVNEKLKEAASSYKNVVLVDWYSASAGNK
FT                   AYFEPDGVHLTKIGAEAYAALVAKEVNQ"
     atgcccgaac cattaaagaa aaatagtcgc tatatggttg gattggacag tctaaggggc        60
     ctagccatac taggtgttat tttgtatcat atcaatttta attggatgcc cggtggattt       120
     ttaggtgtca ctgtattttt tgtactttcc ggttatttaa ttacagatat tctggctata       180
     gaatggaaaa ataataagag aattgatttg aagaaattct ggctcagtag ggcaaggaga       240
     ttacttcctg gaatgcttat catgctcatc gtcaccttag catggattac aatttttcat       300
     agttctttac ttgtaaaaat gcgaggagac tcactagctg ctttattata ttttagtaat       360
     tggtggtata tttatcataa attatcttat tttgatagct ttagtcagct ttccccgcta       420
     aatcactttt ggtcgttagc tgttgaggaa caattttatg tggtctggcc atttgtcatt       480
     agtttggggt tttattacat aaaaaaacaa tcacgcatga tcttatttat ttgtctagga       540
     gcgattgctt ccgctttagc aatggcaatc ctatatgagc caggcactga cccgagtaga       600
     atttattacg gtactgatac acgggctttt tctttactaa ttggagcggc acttgcctta       660
     atttggccaa gcagtaggct tgcgagtaaa attattccgc aagcacgtct tattcttgat       720
     atcattgggg gagttgctct tatcatcatt ctcactatgt tttggaagac gaatcaatat       780
     gagccgtttc tataccgtgg gggaatggtt cttttatcaa ttgctactgc cttgttagtc       840
     gctaacctcg ctcatccagc tagcagaatc gcacaatttt tgagatttag accactgcgt       900
     tggatgggcg tacgatcata tgggatatat cttttgcatt atccgattat tacattgacg       960
     actccgaagg taaatactgg ggagttttcg tttacaagag ccattcttca atttcttctt      1020
     attataattg ttgcacaaat ttcgtggaag tttattgaaa atccaatccg aaaaggcgca      1080
     ttgaagaata ttcggattaa gaacttgaaa ataagaaact taactttaag tggtaagtta      1140
     gttttaatat gtgcagtatt catttcttcg atagctactt ttggattaac aacagctagt      1200
     aaagcaaagg agaatactca aaaagataag gtggaagcag tgcaagaaga acaggctaaa      1260
     catccagttg cagtttggga aaaaccagcc gatgaaccac ctcagaataa agaagaacaa      1320
     aaagaagaga accccgcaca gcctaaagat cctctaacag ttacagctgt aggggactca      1380
     atcatgattg atattgctcc gtatttaaaa aatacttttc ctaatattag gattgatgcg      1440
     aaaataggac ggcaaatgtc acaggcaatc cctgctgtgg aacagctaaa gaatgagggg      1500
     aatttaggaa gtaatgtcat tattggatta ggtacaaatg gagcctttac caaggagcaa      1560
     ttagcatcat taatagaagt aatcgggaat gaacgtaaaa ttatattaat caatacgagg      1620
     gtaccacgtc cgtgggaatc gttggtgaat gagaagctaa aagaagcagc atcatcttac      1680
     aaaaatgtgg tgttagttga ttggtattca gcaagtgctg gaaataaggc gtactttgaa      1740
     ccagatggcg tacatttaac gaaaataggt gcagaagctt atgctgctct tgtagcaaaa      1800
     gaagtgaatc aatag                                                       1815
//

If you have problems or comments...

PBIL Back to PBIL home page