(data stored in ACNUC9435 zone)

EMBL: CP000904.PE78

CP000904.PE78        Location/Qualifiers
FT   CDS_pept        complement(120529..121224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: btl:BALH_2236 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5519"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46502"
FT                   /db_xref="GOA:A9VV70"
FT                   /db_xref="InterPro:IPR039286"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV70"
FT                   /protein_id="ABY46502.1"
FT                   /translation="MSEQCPINVPCQVDGQTQTPLSDAAATPILTPGAPIVKIPVVLAE
FT                   RTIQIVVESDISLDPPAVEIKRILKNVFLTQCKLVPVAFTPIPGTNYRQVTRAKLFVQG
FT                   YIRKNIEYASDDCNGVLYDRIANVPFSGFADLTAADFLSLAIVASSSDTTSHFINPKNG
FT                   DLPRLDKYFFENTVFYNEQPYCELVSAQFFELDFSPCPTDLNEPFDTLREKIVLDLTLK
FT                   VLQVQQVQV"
     atgagcgaac aatgtccaat taatgtacct tgtcaggtag acggacaaac tcaaacacca        60
     ttaagtgatg cagctgcaac accaattctt actccaggag caccgattgt aaaaatacca       120
     gttgtattag cagaaagaac aattcaaatt gttgtagaat ctgatatttc attagatcct       180
     ccagcagttg aaattaaacg tatcttaaaa aacgtatttt taacacaatg taagttagtt       240
     cctgtagcat ttactccaat accaggtaca aattaccgcc aagttacaag agctaaatta       300
     tttgtacaag gatatattcg taaaaatatt gaatatgcaa gtgatgattg taatggagtt       360
     ctatatgacc gcattgcaaa tgttccattt tctggttttg cagatttaac agcagctgat       420
     tttctatctc ttgctatagt agcttcttcc tcagacacta catctcattt tattaatccg       480
     aaaaacggtg atttaccacg tttagacaaa tatttcttcg aaaatacagt tttttataac       540
     gaacaaccat attgcgaatt agtcagcgct caatttttcg aattagactt ttccccttgt       600
     ccaacagatt taaacgagcc atttgatact cttcgcgaaa aaattgtact agatcttact       660
     ttaaaagttt tacaagtaca acaagtacaa gtttag                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page