(data stored in ACNUC9435 zone)

EMBL: CP000904.PE8

CP000904.PE8         Location/Qualifiers
FT   CDS_pept        19253..21001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5440"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lla:L21300 prophage pi3 protein 11"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5440"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46432"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV00"
FT                   /protein_id="ABY46432.1"
FT                   /translation="MAKTLATGMISIVDFNDAPSLSAFVSTTSPKTQIYDPASGTYTPN
FT                   WTSAGPTLTPSLFISTEGTTDAISSAKAVKWYDSIDTSKVIVTGGAYTVTGNTLKISQN
FT                   IMTGSTYAKTFIAEIIWTDPTTLADLVVRAEFTFSRADNGKTGASAISAVLSNDSDVIP
FT                   TDSAGNNGNFTGAISTMTIFEGATDVSASWTVAANPVDITGTLSGKTYTVTGFVAGKDT
FT                   GYVDLTASKSGYASVTRRFALSKSKQGISGTTPTLYRLLSSADAIQKNLAGVYTPTTII
FT                   FTAKSQTGSGAYGDYSGKFTIEETTDGTTFTNKYTSASNEPSKIHTPSAGIKAIRVRLH
FT                   IAGVTPNGSNHIDEQTISVVSDGATGVSGADAVLVSVWAPNGNLFKNDLSTSLTAQADL
FT                   YKGATVQSSGVTYEWFVQKSGNADEGAGTGWDKIDATNQASYGVTGAVNTATITVTAAG
FT                   ITNLAAFKIKATYSSKAYYDTIIFYDQTDPIMVSVESSNGNIFKNGSVSSQILCRLFQN
FT                   GEEIDPKLASATTGYKYTYTWTKLKMDGTQDMDFGGKAISTKTGKWIDITDADIFQKAV
FT                   FKVEIS"
     atggcaaaaa cattagcaac tggtatgatt tccattgtgg attttaatga tgcgccttcc        60
     ttaagcgcat tcgtttccac tacatcacca aagactcaaa tctacgatcc tgcctcagga       120
     acttatactc caaactggac ttccgcaggt ccgactttaa ctccttcatt atttatctct       180
     acagaaggaa ctacagatgc aatctctagt gcaaaagcag ttaagtggta tgactcaatt       240
     gatacgagta aagttattgt gactggcgga gcatacacgg ttacaggcaa cactttaaaa       300
     atctcccaaa acatcatgac aggttcaaca tatgctaaga catttatagc tgaaattatc       360
     tggacagacc caacaacctt agcagactta gtagttcgtg ctgaatttac atttagtcgt       420
     gcagacaatg gtaagactgg tgcatctgct atctcagcag tactaagtaa tgattctgac       480
     gttattccaa cagacagtgc aggtaacaac ggtaacttta ctggtgctat ttcaacgatg       540
     acaatttttg aaggtgcaac tgatgtaagt gctagttgga cagtagcagc aaaccccgtt       600
     gatattactg gtactttatc aggaaaaact tatacagtaa caggattcgt agctggtaaa       660
     gatacagggt atgtagatct tacagcttct aaatcaggtt atgcctcagt tacaagacga       720
     ttcgcattaa gcaaaagtaa gcaaggtata tcaggtacaa cacctacact ataccgatta       780
     ctttcaagtg cggatgccat tcaaaaaaac ctcgcaggag tttatacccc aacaactatt       840
     attttcacag ctaaatctca aactggatca ggcgcatacg gtgactattc aggaaaattc       900
     acaattgaag aaacaacaga cggtacaaca ttcacaaaca aatatacgag tgcttcaaat       960
     gaaccctcaa aaattcatac accatccgca ggcattaaag caattcgagt tcgactccat      1020
     atcgctggcg taacaccaaa tggttcaaac catattgatg aacaaacgat ttctgttgtt      1080
     tccgatggag caacaggtgt atcaggtgcg gatgcggtat tagtatcagt ttgggctccg      1140
     aatggtaact tgtttaaaaa tgacttatca acttcattaa ctgctcaagc agacctttac      1200
     aaaggagcaa cggttcaaag ttctggtgtg acctatgaat ggtttgtgca aaaatcaggt      1260
     aatgcagatg aaggtgccgg aacaggttgg gacaagatag atgctactaa ccaagcttca      1320
     tacggtgtta ctggtgctgt caatacagct acaatcacag ttaccgctgc tggtattaca      1380
     aacttggctg catttaaaat caaagcaact tactcttcga aggcctacta cgacacaatt      1440
     atcttctatg accaaacgga tcctatcatg gtttctgtgg aaagcagcaa cggaaacatc      1500
     ttcaaaaacg gaagcgtatc atcacagatt ttatgtcgcc tattccaaaa tggtgaagag      1560
     attgacccta agctagcttc ggctacaaca ggttataagt acacatatac ttggactaag      1620
     ttgaaaatgg acggaacaca agatatggac tttggcggta aagctatttc aacaaaaaca      1680
     ggaaagtgga tagatattac agatgctgat atttttcaaa aagctgtatt caaggttgaa      1740
     attagctag                                                              1749
//

If you have problems or comments...

PBIL Back to PBIL home page