(data stored in ACNUC9435 zone)

EMBL: CP000904.PE82

CP000904.PE82        Location/Qualifiers
FT   CDS_pept        complement(125270..125434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5524"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: baa:BA_1549 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5524"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46506"
FT                   /db_xref="GOA:A9VV74"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV74"
FT                   /protein_id="ABY46506.1"
FT                   /translation="MPVTLELILFILIAISAIGYLIKEFQKTRKKTLGISIEFLALFWS
FT                   IWRISTIII"
     atgccagtta cactagaact cattcttttc atccttatag caattagtgc tattggttat        60
     ttaataaaag aatttcaaaa gactaggaaa aaaacacttg gaatttcaat agaatttttg       120
     gctcttttct ggtcaatatg gagaatatcg accattataa tctaa                       165
//

If you have problems or comments...

PBIL Back to PBIL home page