(data stored in ACNUC9435 zone)

EMBL: CP000904.PE84

CP000904.PE84        Location/Qualifiers
FT   CDS_pept        126091..126720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5526"
FT                   /product="Recombination protein U"
FT                   /note="PFAM: Recombination protein U; KEGG: btl:BALH_p0007
FT                   recombination protein U (penicillin-binding protein-related
FT                   factor A)"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5526"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46508"
FT                   /db_xref="GOA:A9VV76"
FT                   /db_xref="InterPro:IPR004612"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV76"
FT                   /protein_id="ABY46508.1"
FT                   /translation="MGQGNRGMAFEKLINLVNEMYQRGGVALINKRPTPVKVLKSKGGR
FT                   VLNGFYEAKSTVDYDGVYKGRAIAFEAKSTENPTRFDLKNIAQHQLDYLEKAEKMGAIC
FT                   FFLIEFSKGKSVFVIPLAVIQSYVRMSQQPKGKKSIPRADFDIYGYLVEQTERAPVDYL
FT                   QYVDEAVSPVMFDGMIQFDQDHKKVANNIEAAKEKMNNKKHKLLKA"
     atgggacaag gaaaccgtgg aatggctttt gaaaagctta ttaatctagt gaatgaaatg        60
     tatcaaagag gtggagtggc gcttataaac aagcgtccga ctcctgtgaa ggtgttaaag       120
     agtaaaggtg gccgtgtact aaatggattc tatgaagcta agagtacagt agactatgac       180
     ggggtgtata agggacgagc tatcgcattt gaagcgaagt ctacagagaa ccctacacga       240
     tttgatttaa agaacattgc acagcatcaa ttagattact tggagaaagc ggagaagatg       300
     ggagcgattt gtttcttcct tattgagttt agtaagggca agtcagtatt tgtgatacca       360
     ctggcagtta ttcaatctta cgtaaggatg tcgcaacagc caaaaggcaa gaagtcgata       420
     ccaagagcag actttgatat ttatgggtac ttagtagaac aaacagaacg agcaccagtt       480
     gattacttac aatacgttga tgaagcagta tctccagtta tgtttgatgg catgattcaa       540
     tttgatcagg accataaaaa ggtagcgaat aacattgaag cagcaaaaga gaaaatgaac       600
     aacaaaaaac acaaattact aaaagcttaa                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page