(data stored in ACNUC9435 zone)

EMBL: CP000904.PE85

CP000904.PE85        Location/Qualifiers
FT   CDS_pept        126858..127226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5527"
FT                   /product="phage transcriptional regulator, ArpU family"
FT                   /note="TIGRFAM: phage transcriptional regulator, ArpU
FT                   family; KEGG: bcz:pE33L466_0182 possible prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5527"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46509"
FT                   /db_xref="InterPro:IPR006524"
FT                   /db_xref="InterPro:IPR010861"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV77"
FT                   /protein_id="ABY46509.1"
FT                   /translation="MEQLTLLPAIDDKKVQKEVVSILKEYRALKMRFNNEVEQEGISLF
FT                   PELRNSKTMSQFKVRQIEKVLDDILDDDERSIISMKFLTNKSVKDSFVQNELMISNSYF
FT                   YAKKKSAIKLVATALGII"
     atggaacaat taactttatt accagcaatc gatgacaaga aagtgcaaaa ggaagtagtc        60
     agcatcttaa aggaataccg cgcattaaag atgcgattca ataatgaagt ggaacaagaa       120
     gggatcagtc tgtttccaga gttacgaaat tcgaaaacga tgagtcaatt taaagtaaga       180
     cagattgaga aagtactaga tgatatttta gatgatgatg aaagaagtat tatttcaatg       240
     aagttcttaa ctaataaatc tgtaaaggat tcatttgtac agaatgaact gatgataagt       300
     aactcttact tttatgcgaa gaagaaaagt gctattaaac tggttgctac agcacttggg       360
     attatttaa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page